KEGG   Methanohalophilus mahii: Mmah_1683
Entry
Mmah_1683         CDS       T01211                                 

Name
(GenBank) 4Fe-4S ferredoxin iron-sulfur binding domain protein
  KO
K16183  [Co(II) methylated amine-specific corrinoid protein] reductase [EC:1.16.99.1]
Organism
mmh  Methanohalophilus mahii
Brite
KEGG Orthology (KO) [BR:mmh00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Mmah_1683
Enzymes [BR:mmh01000]
 1. Oxidoreductases
  1.16  Oxidizing metal ions
   1.16.99  With unknown physiological acceptors
    1.16.99.1  [Co(II) methylated amine-specific corrinoid protein] reductase
     Mmah_1683
SSDB
Motif
Pfam: RACo_C_ter Raco_middle Fer4_21 Fer4_6 Fer4_7 Fer4_9 Fer4 Fer4_10 Fer4_2 Fer4_16 Fer4_17 Fer4_4 FGGY_N Fer4_3 CMAS Fer4_8
Other DBs
NCBI-ProteinID: ADE37178
UniProt: D5E7P0
Position
complement(1671628..1673253)
AA seq 541 aa
MYGIAIDLGTSGFRAQLIDLDTKDVLKTAITMRHPLPGGNVMDHLDFSIQVGPEISHEIM
MDTVKKIIERFDVDPADIQRIAICGNPIQLSIFQNIELRDLAYAGKNKQKKLGVENVVRD
ARVFNASEIFEGVISLPNCEIIVPPAIKHEIGADALAMMIETDFYEQEKPSLVTDYGTNA
EMALKIGDKIITGSAAAGPAIEGQGISCGMLASPGAISDVNPEGDYWRITILDEDMSPRK
AHLIDPATGDIKEASDLIAKGITGTGVIAAISVALDTGVITKLPNLPNGKVILADGVEIY
DRDIEEAGKAIGAIRAAHLTLLVEAGLAYDDLDYMYMAGATGAYIDAEKARILGSCPNFS
KSIVQFGNTSISLARELVFDGGRLEEVKEVANRIKADHLMMAESKTFSNFYVCELSYWTQ
GMPIETYNQMLEMYGLPRLPEPYNDPVIEKRVIKDIDEVGKEGLEVVRNLGIVIEEEAPD
CILCRKCEKECPEDAIIALEENGKKYVHYDSEKCLGTSCHRCIAICPVDAIHYIDIDIKT
T
NT seq 1626 nt   +upstreamnt  +downstreamnt
atgtatggtattgctatagatttgggaacaagtggctttcgggcacaattgattgacctt
gatacgaaggatgttctaaagactgctattacaatgcgccatcctttgccgggtggaaat
gtgatggaccatctggatttttcgattcaggtaggtcccgagatttcacatgaaataatg
atggatacagtaaagaaaataatcgaaagatttgatgttgacccggcagatatccaacgc
attgctatatgcggaaaccctatacagctttcaattttccagaatattgaacttcgcgac
cttgcttatgcaggtaaaaacaaacaaaagaagcttggtgttgaaaatgtggtgcgtgat
gcacgggttttcaatgcttctgagatatttgagggtgtgatctcccttccaaattgcgaa
atcatagttccacctgcaatcaaacatgagattggtgcggatgcactggcaatgatgatt
gagaccgatttctatgaacaggaaaaaccttctcttgtaacggattatggtacaaatgcc
gaaatggcattgaaaataggggataagattattaccggcagtgcagctgcgggtcctgca
atagagggacagggaatttcctgtggcatgcttgcaagtcccggtgcgatatccgatgta
aatcctgagggagattattggagaatcactattctggacgaggatatgtctccccgcaaa
gcccatctgattgacccggctacaggtgatataaaagaagccagcgacctgattgcaaag
ggaattaccggtacaggggtaattgcggcaatttcggttgctctggatactggagtaatc
acgaagcttccaaatcttcccaacggtaaagtaattctggctgacggtgtggaaatatac
gacagggatatcgaagaagcaggcaaagcgattggtgcgatacgtgctgcacacctgact
ttacttgttgaagcaggtcttgcatatgatgaccttgattatatgtacatggccggtgca
acaggtgcatatattgatgcggaaaaagccagaatactgggatcctgtccaaacttctcc
aaatcaattgtgcaatttggtaatacttcgatctctcttgcaagggagcttgtatttgat
ggtggtcgtcttgaggaagttaaggaagtagccaacaggataaaagcagatcatttgatg
atggctgaaagcaaaacgttttcgaacttctatgtttgtgaactttcctactggacacag
ggaatgcccattgaaacatacaatcagatgcttgaaatgtatggtcttccaagattaccc
gagccttataatgatcctgtaattgaaaaaagggttataaaagatattgatgaagtaggc
aaagaaggtcttgaagttgtgcgcaatctgggtatcgtaatagaagaggaggctccggat
tgtattctctgtcgtaagtgtgagaaggaatgccctgaagatgctattatagcgctggaa
gagaatggtaagaaatatgtgcattatgatagtgaaaaatgccttggaacttcctgtcat
cgctgtattgcaatttgtccggtggacgcaattcattatatagatatagatattaaaaca
acgtga

DBGET integrated database retrieval system