KEGG   Methanococcus maripaludis S2: MMP1450
Entry
MMP1450           CDS       T00164                                 
Symbol
ehaC
Name
(GenBank) conserved hypothetical protein
  KO
K14094  energy-converting hydrogenase A subunit C
Organism
mmp  Methanococcus maripaludis S2
Brite
KEGG Orthology (KO) [BR:mmp00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99982 Energy metabolism
    MMP1450 (ehaC)
SSDB
Motif
Pfam: DUF2109
Other DBs
NCBI-ProteinID: CAF31006
UniProt: Q6LXA2
Position
1418815..1419081
AA seq 88 aa
MESLVTVTIGLIGIISVIKVFLTKSRALKLPIICCINFCIAALIALYIKSPMGAVAAVVY
FALSTVSSNAIAHTLGEIDKMDEFEKKR
NT seq 267 nt   +upstreamnt  +downstreamnt
atggaatctcttgtaaccgttacaattggacttatagggataatttccgttataaaagta
tttctgacaaaaagcagagctttaaaactccctattatttgttgtattaacttctgtatt
gcagcattgattgcactctacataaaaagcccgatgggtgcagttgcagcagttgtttac
tttgcattatcaacagtatccagtaatgcgatagcccatactcttggagaaatcgacaaa
atggatgaatttgagaagaaaaggtga

DBGET integrated database retrieval system