KEGG   Mus musculus (mouse): 100504404
Entry
100504404         CDS       T01002                                 

Gene name
H2-Ea, AI323765, E-alpha-f, H-2E, H-2Ea, H2-Ea-ps, I, I-E, I-Ealpha, Ia, Ia-3, Ia3, MHC-H2-Ea
Definition
(RefSeq) histocompatibility 2, class II antigen E alpha
  KO
K06752  MHC class II antigen
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04145  Phagosome
mmu04514  Cell adhesion molecules
mmu04612  Antigen processing and presentation
mmu04640  Hematopoietic cell lineage
mmu04658  Th1 and Th2 cell differentiation
mmu04659  Th17 cell differentiation
mmu04672  Intestinal immune network for IgA production
mmu04940  Type I diabetes mellitus
mmu05140  Leishmaniasis
mmu05145  Toxoplasmosis
mmu05150  Staphylococcus aureus infection
mmu05152  Tuberculosis
mmu05164  Influenza A
mmu05166  Human T-cell leukemia virus 1 infection
mmu05168  Herpes simplex virus 1 infection
mmu05169  Epstein-Barr virus infection
mmu05310  Asthma
mmu05320  Autoimmune thyroid disease
mmu05321  Inflammatory bowel disease
mmu05322  Systemic lupus erythematosus
mmu05323  Rheumatoid arthritis
mmu05330  Allograft rejection
mmu05332  Graft-versus-host disease
mmu05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    100504404 (H2-Ea)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    100504404 (H2-Ea)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100504404 (H2-Ea)
   04612 Antigen processing and presentation
    100504404 (H2-Ea)
   04658 Th1 and Th2 cell differentiation
    100504404 (H2-Ea)
   04659 Th17 cell differentiation
    100504404 (H2-Ea)
   04672 Intestinal immune network for IgA production
    100504404 (H2-Ea)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100504404 (H2-Ea)
   05164 Influenza A
    100504404 (H2-Ea)
   05168 Herpes simplex virus 1 infection
    100504404 (H2-Ea)
   05169 Epstein-Barr virus infection
    100504404 (H2-Ea)
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    100504404 (H2-Ea)
   05152 Tuberculosis
    100504404 (H2-Ea)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100504404 (H2-Ea)
   05140 Leishmaniasis
    100504404 (H2-Ea)
  09163 Immune disease
   05310 Asthma
    100504404 (H2-Ea)
   05322 Systemic lupus erythematosus
    100504404 (H2-Ea)
   05323 Rheumatoid arthritis
    100504404 (H2-Ea)
   05320 Autoimmune thyroid disease
    100504404 (H2-Ea)
   05321 Inflammatory bowel disease
    100504404 (H2-Ea)
   05330 Allograft rejection
    100504404 (H2-Ea)
   05332 Graft-versus-host disease
    100504404 (H2-Ea)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    100504404 (H2-Ea)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    100504404 (H2-Ea)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    100504404 (H2-Ea)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100504404 (H2-Ea)
  Exosomal proteins of epithelial cells
   100504404 (H2-Ea)
  Exosomal proteins of breast milk
   100504404 (H2-Ea)
SSDB
Motif
Pfam: MHC_II_alpha C1-set Ig_3 C2-set_2 Ig_2 Marek_A
Other DBs
NCBI-GeneID: 100504404
NCBI-ProteinID: NP_034511
MGI: 95900
Ensembl: ENSMUSG00000036322
UniProt: P04224 P14439 A0A290WGA7
Structure
PDB: 

Position
17 B1; 17 17.98 cM
AA seq 255 aa
MATIGALVLRFFFIAVLMSSQKSWAIKEEHTIIQAEFYLLPDKRGEFMFDFDGDEIFHVD
IEKSETIWRLEEFAKFASFEAQGALANIAVDKANLDVMKERSNNTPDANVAPEVTVLSRS
PVNLGEPNILICFIDKFSPPVVNVTWLRNGRPVTEGVSETVFLPRDDHLFRKFHYLTFLP
STDDFYDCEVDHWGLEEPLRKHWEFEEKTLLPETKENVVCALGLFVGLVGIVVGIILIMK
GIKKRNVVERRQGAL
NT seq 768 nt   +upstreamnt  +downstreamnt
atggccacaattggagccctggtgttaagatttttcttcattgctgttctgatgagctcc
cagaagtcatgggctatcaaagaggaacacaccatcatccaggcggagttctatctttta
ccagacaaacgtggagagtttatgtttgactttgacggcgatgagattttccatgtagac
attgaaaagtcagagaccatctggagacttgaagaatttgcaaagtttgccagctttgag
gctcagggtgcactggctaatatagctgtggacaaagctaacctggatgtcatgaaagag
cgttccaacaacactccagatgccaacgtggccccagaggtgactgtactctccagaagc
cctgtgaacctgggagagcccaacatcctcatctgtttcattgacaagttctcccctcca
gtggtcaatgtcacctggctccggaatggacggcctgtcaccgaaggcgtgtcagagaca
gtgtttctcccgagggacgatcacctcttccgcaaattccactatctgaccttcctgccc
tccacagatgatttctatgactgtgaggtggatcactggggtttggaggagcccctgcgg
aagcactgggagtttgaagagaaaaccctcctcccagaaactaaagagaatgtcgtgtgt
gctcttgggttgtttgtgggtctggtgggcatcgttgtggggattatcctcatcatgaag
ggtattaaaaaacgcaatgttgtagaacgccgacaaggagccctgtga

KEGG   Mus musculus (mouse): 14960
Entry
14960             CDS       T01002                                 

Gene name
H2-Aa, A, Aalpha, H-2, H-2Aa, H2Aa, I, I-, I-Aalpha, IAalpha, Ia, Ia-1, Ia1
Definition
(RefSeq) histocompatibility 2, class II antigen A, alpha
  KO
K06752  MHC class II antigen
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04145  Phagosome
mmu04514  Cell adhesion molecules
mmu04612  Antigen processing and presentation
mmu04640  Hematopoietic cell lineage
mmu04658  Th1 and Th2 cell differentiation
mmu04659  Th17 cell differentiation
mmu04672  Intestinal immune network for IgA production
mmu04940  Type I diabetes mellitus
mmu05140  Leishmaniasis
mmu05145  Toxoplasmosis
mmu05150  Staphylococcus aureus infection
mmu05152  Tuberculosis
mmu05164  Influenza A
mmu05166  Human T-cell leukemia virus 1 infection
mmu05168  Herpes simplex virus 1 infection
mmu05169  Epstein-Barr virus infection
mmu05310  Asthma
mmu05320  Autoimmune thyroid disease
mmu05321  Inflammatory bowel disease
mmu05322  Systemic lupus erythematosus
mmu05323  Rheumatoid arthritis
mmu05330  Allograft rejection
mmu05332  Graft-versus-host disease
mmu05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    14960 (H2-Aa)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    14960 (H2-Aa)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    14960 (H2-Aa)
   04612 Antigen processing and presentation
    14960 (H2-Aa)
   04658 Th1 and Th2 cell differentiation
    14960 (H2-Aa)
   04659 Th17 cell differentiation
    14960 (H2-Aa)
   04672 Intestinal immune network for IgA production
    14960 (H2-Aa)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    14960 (H2-Aa)
   05164 Influenza A
    14960 (H2-Aa)
   05168 Herpes simplex virus 1 infection
    14960 (H2-Aa)
   05169 Epstein-Barr virus infection
    14960 (H2-Aa)
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    14960 (H2-Aa)
   05152 Tuberculosis
    14960 (H2-Aa)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    14960 (H2-Aa)
   05140 Leishmaniasis
    14960 (H2-Aa)
  09163 Immune disease
   05310 Asthma
    14960 (H2-Aa)
   05322 Systemic lupus erythematosus
    14960 (H2-Aa)
   05323 Rheumatoid arthritis
    14960 (H2-Aa)
   05320 Autoimmune thyroid disease
    14960 (H2-Aa)
   05321 Inflammatory bowel disease
    14960 (H2-Aa)
   05330 Allograft rejection
    14960 (H2-Aa)
   05332 Graft-versus-host disease
    14960 (H2-Aa)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    14960 (H2-Aa)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    14960 (H2-Aa)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    14960 (H2-Aa)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   14960 (H2-Aa)
  Exosomal proteins of epithelial cells
   14960 (H2-Aa)
  Exosomal proteins of breast milk
   14960 (H2-Aa)
SSDB
Motif
Pfam: MHC_II_alpha C1-set Ig_3 Marek_A SKG6 C2-set_2
Other DBs
NCBI-GeneID: 14960
NCBI-ProteinID: NP_034508
MGI: 95895
Ensembl: ENSMUSG00000036594
Vega: OTTMUSG00000037121
UniProt: P14434
Structure
PDB: 

Position
17 B1; 17 17.98 cM
AA seq 256 aa
MPRSRALILGVLALTTMLSLCGGEDDIEADHVGTYGISVYQSPGDIGQYTFEFDGDELFY
VDLDKKETVWMLPEFGQLASFDPQGGLQNIAVVKHNLGVLTKRSNSTPATNEAPQATVFP
KSPVLLGQPNTLICFVDNIFPPVINITWLRNSKSVADGVYETSFFVNRDYSFHKLSYLTF
IPSDDDIYDCKVEHWGLEEPVLKHWEPEIPAPMSELTETVVCALGLSVGLVGIVVGTIFI
IQGLRSGGTSRHPGPL
NT seq 771 nt   +upstreamnt  +downstreamnt
atgccgcgcagcagagctctgattctgggggtcctcgccctgaccaccatgctcagcctc
tgtggaggtgaagacgacattgaggccgaccacgtaggcacctatggtataagtgtatat
cagtctcctggagacattggccagtacacatttgaatttgatggtgatgagttgttctat
gtggacttggataagaaggagactgtctggatgcttcctgagtttggccaattggcaagc
tttgacccccaaggtggactgcaaaacatagctgtagtaaaacacaacttgggagtcttg
actaagaggtcaaattccaccccagctaccaatgaggctcctcaagcgactgtgttcccc
aagtcccctgtgctgctgggtcagcccaacaccctcatctgctttgtggacaacatcttc
cctcctgtgatcaacatcacatggctcagaaatagcaagtcagtcgcagacggtgtttat
gagaccagcttcttcgtcaaccgtgactattccttccacaagctgtcttatctcaccttc
atcccttctgacgatgacatttatgactgcaaggtggaacactggggcctggaggagccg
gttctgaaacactgggaacctgagattccagcccccatgtcagagctgacagagactgtg
gtctgtgccctggggttgtctgtgggccttgtgggcatcgtggtgggcaccatcttcatc
attcaaggcctgcgatcaggtggcacctccagacacccagggcctttatga

KEGG   Mus musculus (mouse): 14961
Entry
14961             CDS       T01002                                 

Gene name
H2-Ab1, AI845868, Abe, Abeta, H-2A, H-2Ab, H2-A, H2-Ab, H2-Ab_, I, I-A<, I-Ab, I-Abeta, IAb, Ia, Ia-2, Ia2, Rmc, Rmcs1
Definition
(RefSeq) histocompatibility 2, class II antigen A, beta 1
  KO
K06752  MHC class II antigen
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04145  Phagosome
mmu04514  Cell adhesion molecules
mmu04612  Antigen processing and presentation
mmu04640  Hematopoietic cell lineage
mmu04658  Th1 and Th2 cell differentiation
mmu04659  Th17 cell differentiation
mmu04672  Intestinal immune network for IgA production
mmu04940  Type I diabetes mellitus
mmu05140  Leishmaniasis
mmu05145  Toxoplasmosis
mmu05150  Staphylococcus aureus infection
mmu05152  Tuberculosis
mmu05164  Influenza A
mmu05166  Human T-cell leukemia virus 1 infection
mmu05168  Herpes simplex virus 1 infection
mmu05169  Epstein-Barr virus infection
mmu05310  Asthma
mmu05320  Autoimmune thyroid disease
mmu05321  Inflammatory bowel disease
mmu05322  Systemic lupus erythematosus
mmu05323  Rheumatoid arthritis
mmu05330  Allograft rejection
mmu05332  Graft-versus-host disease
mmu05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    14961 (H2-Ab1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    14961 (H2-Ab1)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    14961 (H2-Ab1)
   04612 Antigen processing and presentation
    14961 (H2-Ab1)
   04658 Th1 and Th2 cell differentiation
    14961 (H2-Ab1)
   04659 Th17 cell differentiation
    14961 (H2-Ab1)
   04672 Intestinal immune network for IgA production
    14961 (H2-Ab1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    14961 (H2-Ab1)
   05164 Influenza A
    14961 (H2-Ab1)
   05168 Herpes simplex virus 1 infection
    14961 (H2-Ab1)
   05169 Epstein-Barr virus infection
    14961 (H2-Ab1)
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    14961 (H2-Ab1)
   05152 Tuberculosis
    14961 (H2-Ab1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    14961 (H2-Ab1)
   05140 Leishmaniasis
    14961 (H2-Ab1)
  09163 Immune disease
   05310 Asthma
    14961 (H2-Ab1)
   05322 Systemic lupus erythematosus
    14961 (H2-Ab1)
   05323 Rheumatoid arthritis
    14961 (H2-Ab1)
   05320 Autoimmune thyroid disease
    14961 (H2-Ab1)
   05321 Inflammatory bowel disease
    14961 (H2-Ab1)
   05330 Allograft rejection
    14961 (H2-Ab1)
   05332 Graft-versus-host disease
    14961 (H2-Ab1)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    14961 (H2-Ab1)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    14961 (H2-Ab1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    14961 (H2-Ab1)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   14961 (H2-Ab1)
  Exosomal proteins of epithelial cells
   14961 (H2-Ab1)
  Exosomal proteins of breast milk
   14961 (H2-Ab1)
SSDB
Motif
Pfam: MHC_II_beta C1-set Ig_3 C2-set_2 ig MHC_I DUF3592
Other DBs
NCBI-GeneID: 14961
NCBI-ProteinID: NP_996988
MGI: 103070
Ensembl: ENSMUSG00000073421
Vega: OTTMUSG00000037120
UniProt: P14483 Q8BPA0 Q3TD53
Structure
PDB: 

Position
17 B1; 17 17.98 cM
AA seq 265 aa
MALQIPSLLLSAAVVVLMVLSSPGTEGGDSERHFVYQFMGECYFTNGTQRIRYVTRYIYN
REEYVRYDSDVGEHRAVTELGRPDAEYWNSQPEILERTRAELDTVCRHNYEGPETHTSLR
RLEQPNVVISLSRTEALNHHNTLVCSVTDFYPAKIKVRWFRNGQEETVGVSSTQLIRNGD
WTFQVLVMLEMTPRRGEVYTCHVEHPSLKSPITVEWRAQSESAWSKMLSGIGGCVLGVIF
LGLGLFIRHRSQKGPRGPPPAGLLQ
NT seq 798 nt   +upstreamnt  +downstreamnt
atggctctgcagatccccagcctcctcctctcggctgctgtggtggtgctgatggtgctg
agcagcccagggactgagggcggagactccgaaaggcatttcgtgtaccagttcatgggc
gagtgctacttcaccaacgggacgcagcgcatacgatatgtgaccagatacatctacaac
cgggaggagtacgtgcgctacgacagcgacgtgggcgagcaccgcgcggtgaccgagctg
gggcggccagacgccgagtactggaacagccagccggagatcctggagcgaacgcgggcc
gagctggacacggtgtgcagacacaactacgaggggccggagacccacacctccctgcgg
cggcttgaacagcccaatgtcgtcatctccctgtccaggacagaggccctcaaccaccac
aacactctggtctgctcagtgacagatttctacccagccaagatcaaagtgcgctggttc
cggaatggccaggaggagacggtgggggtctcatccacacagcttattaggaatggggac
tggaccttccaggtcctggtcatgctggagatgacccctcggcggggagaggtctacacc
tgtcacgtggagcatcccagcctgaagagccccatcactgtggagtggagggcacagtct
gagtctgcctggagcaagatgttgagcggcatcgggggctgcgtgcttggggtgatcttc
ctcgggcttggccttttcatccgtcacaggagtcagaaaggacctcgaggccctcctcca
gcagggctcctgcagtga

KEGG   Mus musculus (mouse): 14969
Entry
14969             CDS       T01002                                 

Gene name
H2-Eb1, Eb, H-2Eb, H2-Eb_p, H2Eb, I, Ia, Ia-4, Ia4
Definition
(RefSeq) histocompatibility 2, class II antigen E beta
  KO
K06752  MHC class II antigen
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04145  Phagosome
mmu04514  Cell adhesion molecules
mmu04612  Antigen processing and presentation
mmu04640  Hematopoietic cell lineage
mmu04658  Th1 and Th2 cell differentiation
mmu04659  Th17 cell differentiation
mmu04672  Intestinal immune network for IgA production
mmu04940  Type I diabetes mellitus
mmu05140  Leishmaniasis
mmu05145  Toxoplasmosis
mmu05150  Staphylococcus aureus infection
mmu05152  Tuberculosis
mmu05164  Influenza A
mmu05166  Human T-cell leukemia virus 1 infection
mmu05168  Herpes simplex virus 1 infection
mmu05169  Epstein-Barr virus infection
mmu05310  Asthma
mmu05320  Autoimmune thyroid disease
mmu05321  Inflammatory bowel disease
mmu05322  Systemic lupus erythematosus
mmu05323  Rheumatoid arthritis
mmu05330  Allograft rejection
mmu05332  Graft-versus-host disease
mmu05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    14969 (H2-Eb1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    14969 (H2-Eb1)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    14969 (H2-Eb1)
   04612 Antigen processing and presentation
    14969 (H2-Eb1)
   04658 Th1 and Th2 cell differentiation
    14969 (H2-Eb1)
   04659 Th17 cell differentiation
    14969 (H2-Eb1)
   04672 Intestinal immune network for IgA production
    14969 (H2-Eb1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    14969 (H2-Eb1)
   05164 Influenza A
    14969 (H2-Eb1)
   05168 Herpes simplex virus 1 infection
    14969 (H2-Eb1)
   05169 Epstein-Barr virus infection
    14969 (H2-Eb1)
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    14969 (H2-Eb1)
   05152 Tuberculosis
    14969 (H2-Eb1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    14969 (H2-Eb1)
   05140 Leishmaniasis
    14969 (H2-Eb1)
  09163 Immune disease
   05310 Asthma
    14969 (H2-Eb1)
   05322 Systemic lupus erythematosus
    14969 (H2-Eb1)
   05323 Rheumatoid arthritis
    14969 (H2-Eb1)
   05320 Autoimmune thyroid disease
    14969 (H2-Eb1)
   05321 Inflammatory bowel disease
    14969 (H2-Eb1)
   05330 Allograft rejection
    14969 (H2-Eb1)
   05332 Graft-versus-host disease
    14969 (H2-Eb1)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    14969 (H2-Eb1)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    14969 (H2-Eb1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    14969 (H2-Eb1)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   14969 (H2-Eb1)
  Exosomal proteins of epithelial cells
   14969 (H2-Eb1)
  Exosomal proteins of breast milk
   14969 (H2-Eb1)
SSDB
Motif
Pfam: MHC_II_beta C1-set Ig_3 ig Ig_2 Marek_A DUF202
Other DBs
NCBI-GeneID: 14969
NCBI-ProteinID: NP_034512
MGI: 95901
Ensembl: ENSMUSG00000060586
Vega: OTTMUSG00000037123
UniProt: O78196
Structure
PDB: 

Position
17 B1; 17 17.98 cM
AA seq 264 aa
MVWLPRVPCVAAVILLLTVLSPPVALVRDSRPWFLEYCKSECHFYNGTQRVRLLERYFYN
LEENLRFDSDVGEFRAVTELGRPDAENWNSQPEFLEQKRAEVDTVCRHNYEISDKFLVRR
RVEPTVTVYPTKTQPLEHHNLLVCSVSDFYPGNIEVRWFRNGKEEKTGIVSTGLVRNGDW
TFQTLVMLETVPQSGEVYTCQVEHPSLTDPVTVEWKAQSTSAQNKMLSGVGGFVLGLLFL
GAGLFIYFRNQKGQSGLQPTGLLS
NT seq 795 nt   +upstreamnt  +downstreamnt
atggtgtggctccccagagttccctgtgtggcagctgtgatcctgttgctgacagtgctg
agccctccagtggctttggtcagagactccagaccatggtttttggaatactgtaaatct
gagtgtcatttctacaacgggacgcagcgcgtgcggcttctggaaagatacttctacaac
ctggaggagaacctgcgcttcgacagcgacgtgggcgagttccgcgcggtgaccgagctg
gggcggccagacgccgagaactggaacagccagccggagttcctggagcaaaagcgggcc
gaggtggacacggtgtgcagacacaactatgagatctcggataaattccttgtgcggcgg
agagttgagcctacggtgactgtgtaccccacaaagacacagcccctggaacaccacaac
ctcctggtctgctctgtgagtgacttctaccctggcaacattgaagtcagatggttccgg
aatggcaaggaggagaaaacaggaattgtgtccacgggcctggtccgaaatggagactgg
accttccagacactggtgatgctggagacggttcctcagagtggagaggtttacacctgc
caggtggagcatcccagcctgaccgaccctgtcacggtcgagtggaaagcacaatccaca
tctgcacagaacaagatgttgagtggagttgggggcttcgtgctgggcctgctcttcctg
ggagcggggctgttcatctacttcaggaaccagaaaggacagtctggacttcagccaaca
ggactcctgagctga

KEGG   Mus musculus (mouse): 14998
Entry
14998             CDS       T01002                                 

Gene name
H2-DMa, H-2M, H-2Ma, H2-M, H2-Ma
Definition
(RefSeq) histocompatibility 2, class II, locus DMa
  KO
K06752  MHC class II antigen
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04145  Phagosome
mmu04514  Cell adhesion molecules
mmu04612  Antigen processing and presentation
mmu04640  Hematopoietic cell lineage
mmu04658  Th1 and Th2 cell differentiation
mmu04659  Th17 cell differentiation
mmu04672  Intestinal immune network for IgA production
mmu04940  Type I diabetes mellitus
mmu05140  Leishmaniasis
mmu05145  Toxoplasmosis
mmu05150  Staphylococcus aureus infection
mmu05152  Tuberculosis
mmu05164  Influenza A
mmu05166  Human T-cell leukemia virus 1 infection
mmu05168  Herpes simplex virus 1 infection
mmu05169  Epstein-Barr virus infection
mmu05310  Asthma
mmu05320  Autoimmune thyroid disease
mmu05321  Inflammatory bowel disease
mmu05322  Systemic lupus erythematosus
mmu05323  Rheumatoid arthritis
mmu05330  Allograft rejection
mmu05332  Graft-versus-host disease
mmu05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    14998 (H2-DMa)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    14998 (H2-DMa)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    14998 (H2-DMa)
   04612 Antigen processing and presentation
    14998 (H2-DMa)
   04658 Th1 and Th2 cell differentiation
    14998 (H2-DMa)
   04659 Th17 cell differentiation
    14998 (H2-DMa)
   04672 Intestinal immune network for IgA production
    14998 (H2-DMa)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    14998 (H2-DMa)
   05164 Influenza A
    14998 (H2-DMa)
   05168 Herpes simplex virus 1 infection
    14998 (H2-DMa)
   05169 Epstein-Barr virus infection
    14998 (H2-DMa)
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    14998 (H2-DMa)
   05152 Tuberculosis
    14998 (H2-DMa)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    14998 (H2-DMa)
   05140 Leishmaniasis
    14998 (H2-DMa)
  09163 Immune disease
   05310 Asthma
    14998 (H2-DMa)
   05322 Systemic lupus erythematosus
    14998 (H2-DMa)
   05323 Rheumatoid arthritis
    14998 (H2-DMa)
   05320 Autoimmune thyroid disease
    14998 (H2-DMa)
   05321 Inflammatory bowel disease
    14998 (H2-DMa)
   05330 Allograft rejection
    14998 (H2-DMa)
   05332 Graft-versus-host disease
    14998 (H2-DMa)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    14998 (H2-DMa)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    14998 (H2-DMa)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    14998 (H2-DMa)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   14998 (H2-DMa)
  Exosomal proteins of epithelial cells
   14998 (H2-DMa)
  Exosomal proteins of breast milk
   14998 (H2-DMa)
SSDB
Motif
Pfam: MHC_II_alpha C1-set
Other DBs
NCBI-GeneID: 14998
NCBI-ProteinID: NP_001347459
MGI: 95921
Ensembl: ENSMUSG00000037649
Vega: OTTMUSG00000037115
Structure
PDB: 
1K8I

Position
17 B1; 17 17.98 cM
AA seq 261 aa
MEHEQKSGAVLLRLLRLLWLLPHSWAVLEASTPVFWDDPQNHTFRHTLFCQDGIPNIGLS
ETYDEDELFSFDFSQNTRVPRLPDFAEWAQGQGDASAIAFDKSFCEMLMREVSPKLEGQI
PVSRGLPVAEVFTLKPLEFGKPNTLVCFISNLFPPTLTVNWQLHSAPVEGASPTSISAVD
GLTFQAFSYLNFTPEPFDLYSCTVTHEIDRYTAIAYWVPQNALPSDLLENALCGVAFGLG
VLGTIMGIVFFLCSQRPCSGD
NT seq 786 nt   +upstreamnt  +downstreamnt
atggagcatgagcagaagtcaggagctgtgctgctgaggctgctgcgccttctgtggctg
ctgccccactcctgggcggtgctcgaagcatctacaccagtgttctgggatgacccacag
aaccacacattccggcacactctattctgccaggacgggattcccaacatagggctctcg
gagacctatgacgaggacgaactcttctccttcgacttctcccagaacaccagagtgccc
cgactgcctgactttgcagagtgggctcagggacagggggatgcctctgccattgcattt
gacaaaagcttctgcgagatgttgatgcgggaagtgagcccgaagcttgaaggtcaaatc
ccagtgtccagaggtttgcctgtggcagaggtattcacactgaagcccctggagtttggc
aagcccaacacgttggtctgtttcatcagcaacctctttccaccgaccctgaccgtgaac
tggcagcttcactcggcccctgtggagggagccagccccacatccatctcagctgtcgat
gggctgaccttccaggctttctcttatttaaacttcacaccggaaccctttgacctttac
tcctgcactgtgacacacgagattgaccgctacacggcaattgcctattgggtaccccag
aacgccctgccttcggatctcctagagaatgccctgtgtggtgtggcctttggcctcggt
gtgctaggcaccatcatgggcattgtcttcttcctctgctcccagagaccgtgctcaggt
gactga

KEGG   Mus musculus (mouse): 14999
Entry
14999             CDS       T01002                                 

Gene name
H2-DMb1, AI385589, H-2Mb1, H2-Mb1
Definition
(RefSeq) histocompatibility 2, class II, locus Mb1
  KO
K06752  MHC class II antigen
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04145  Phagosome
mmu04514  Cell adhesion molecules
mmu04612  Antigen processing and presentation
mmu04640  Hematopoietic cell lineage
mmu04658  Th1 and Th2 cell differentiation
mmu04659  Th17 cell differentiation
mmu04672  Intestinal immune network for IgA production
mmu04940  Type I diabetes mellitus
mmu05140  Leishmaniasis
mmu05145  Toxoplasmosis
mmu05150  Staphylococcus aureus infection
mmu05152  Tuberculosis
mmu05164  Influenza A
mmu05166  Human T-cell leukemia virus 1 infection
mmu05168  Herpes simplex virus 1 infection
mmu05169  Epstein-Barr virus infection
mmu05310  Asthma
mmu05320  Autoimmune thyroid disease
mmu05321  Inflammatory bowel disease
mmu05322  Systemic lupus erythematosus
mmu05323  Rheumatoid arthritis
mmu05330  Allograft rejection
mmu05332  Graft-versus-host disease
mmu05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    14999 (H2-DMb1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    14999 (H2-DMb1)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    14999 (H2-DMb1)
   04612 Antigen processing and presentation
    14999 (H2-DMb1)
   04658 Th1 and Th2 cell differentiation
    14999 (H2-DMb1)
   04659 Th17 cell differentiation
    14999 (H2-DMb1)
   04672 Intestinal immune network for IgA production
    14999 (H2-DMb1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    14999 (H2-DMb1)
   05164 Influenza A
    14999 (H2-DMb1)
   05168 Herpes simplex virus 1 infection
    14999 (H2-DMb1)
   05169 Epstein-Barr virus infection
    14999 (H2-DMb1)
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    14999 (H2-DMb1)
   05152 Tuberculosis
    14999 (H2-DMb1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    14999 (H2-DMb1)
   05140 Leishmaniasis
    14999 (H2-DMb1)
  09163 Immune disease
   05310 Asthma
    14999 (H2-DMb1)
   05322 Systemic lupus erythematosus
    14999 (H2-DMb1)
   05323 Rheumatoid arthritis
    14999 (H2-DMb1)
   05320 Autoimmune thyroid disease
    14999 (H2-DMb1)
   05321 Inflammatory bowel disease
    14999 (H2-DMb1)
   05330 Allograft rejection
    14999 (H2-DMb1)
   05332 Graft-versus-host disease
    14999 (H2-DMb1)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    14999 (H2-DMb1)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    14999 (H2-DMb1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    14999 (H2-DMb1)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   14999 (H2-DMb1)
  Exosomal proteins of epithelial cells
   14999 (H2-DMb1)
  Exosomal proteins of breast milk
   14999 (H2-DMb1)
SSDB
Motif
Pfam: MHC_II_beta C1-set Ig_2 Ig_3 C2-set_2 I-set ig
Other DBs
NCBI-GeneID: 14999
NCBI-ProteinID: NP_034517
MGI: 95922
Ensembl: ENSMUSG00000079547
Vega: OTTMUSG00000037116
UniProt: Q31094
Position
17 B1; 17 17.98 cM
AA seq 261 aa
MAALWLLLLVLSLDCMGAGGFVAHVESTCVLDDAGTPQDFTYCVSFNKDLLACWDPDVGK
IVPCEFGVLYPWAENFSRILNKEESLLQRLQNGLLDCASHTQPFWNALTHRTRAPSVRVA
QTTPFNTREPVMLACYVWGFYPADVTITWMKNGQLVPSHSNKEKTAQPNGDWTYQTVSYL
ALTPSYGDVYTCVVQHSGTSEPIRGDWTPGLSPIQTVKVSVSAATLGLGFIIFCVGFFRW
RKSHSSSYTPLSGSTYPEGQH
NT seq 786 nt   +upstreamnt  +downstreamnt
atggctgcactctggctgctgctgctggtcctcagtctggactgtatgggggcaggtggc
tttgtggctcatgtggaaagcacgtgcgtgctggatgatgctgggaccccacaggacttc
acatactgtgtttccttcaacaaagatctgctggcctgctgggatccagatgtgggaaaa
atagtcccctgtgaatttggggtgctgtatccatgggccgaaaatttttcaaggatcctc
aacaaagaagagagccttctccagcgtttgcaaaacgggcttctggactgtgcctcccac
acccagcccttctggaatgcgctgacccacagaacgagagcgccatctgtccgagtagcc
caaaccacaccttttaacacaagggagccggtgatgctggcctgctacgtctggggcttc
tatccagcggatgtgaccatcacatggatgaagaatgggcagcttgtcccttcccacagc
aacaaggagaagacggctcagcccaatggagactggacataccagacagtctcctaccta
gccctaaccccttcctacggggacgtctacacctgcgtggttcagcacagcgggacctct
gagcccatccgaggggactggacacctgggctgtcccccatccagacagtgaaggtctct
gtgtctgcagccaccctgggcctgggcttcatcatcttctgtgttggcttcttcagatgg
cgcaagtctcattcctccagctacactcctctctctggatccacctacccggaaggacag
cattag

KEGG   Mus musculus (mouse): 15000
Entry
15000             CDS       T01002                                 

Gene name
H2-DMb2, H-2Mb2, H2-Mb2
Definition
(RefSeq) histocompatibility 2, class II, locus Mb2
  KO
K06752  MHC class II antigen
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04145  Phagosome
mmu04514  Cell adhesion molecules
mmu04612  Antigen processing and presentation
mmu04640  Hematopoietic cell lineage
mmu04658  Th1 and Th2 cell differentiation
mmu04659  Th17 cell differentiation
mmu04672  Intestinal immune network for IgA production
mmu04940  Type I diabetes mellitus
mmu05140  Leishmaniasis
mmu05145  Toxoplasmosis
mmu05150  Staphylococcus aureus infection
mmu05152  Tuberculosis
mmu05164  Influenza A
mmu05166  Human T-cell leukemia virus 1 infection
mmu05168  Herpes simplex virus 1 infection
mmu05169  Epstein-Barr virus infection
mmu05310  Asthma
mmu05320  Autoimmune thyroid disease
mmu05321  Inflammatory bowel disease
mmu05322  Systemic lupus erythematosus
mmu05323  Rheumatoid arthritis
mmu05330  Allograft rejection
mmu05332  Graft-versus-host disease
mmu05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    15000 (H2-DMb2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    15000 (H2-DMb2)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    15000 (H2-DMb2)
   04612 Antigen processing and presentation
    15000 (H2-DMb2)
   04658 Th1 and Th2 cell differentiation
    15000 (H2-DMb2)
   04659 Th17 cell differentiation
    15000 (H2-DMb2)
   04672 Intestinal immune network for IgA production
    15000 (H2-DMb2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    15000 (H2-DMb2)
   05164 Influenza A
    15000 (H2-DMb2)
   05168 Herpes simplex virus 1 infection
    15000 (H2-DMb2)
   05169 Epstein-Barr virus infection
    15000 (H2-DMb2)
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    15000 (H2-DMb2)
   05152 Tuberculosis
    15000 (H2-DMb2)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    15000 (H2-DMb2)
   05140 Leishmaniasis
    15000 (H2-DMb2)
  09163 Immune disease
   05310 Asthma
    15000 (H2-DMb2)
   05322 Systemic lupus erythematosus
    15000 (H2-DMb2)
   05323 Rheumatoid arthritis
    15000 (H2-DMb2)
   05320 Autoimmune thyroid disease
    15000 (H2-DMb2)
   05321 Inflammatory bowel disease
    15000 (H2-DMb2)
   05330 Allograft rejection
    15000 (H2-DMb2)
   05332 Graft-versus-host disease
    15000 (H2-DMb2)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    15000 (H2-DMb2)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    15000 (H2-DMb2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    15000 (H2-DMb2)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   15000 (H2-DMb2)
  Exosomal proteins of epithelial cells
   15000 (H2-DMb2)
  Exosomal proteins of breast milk
   15000 (H2-DMb2)
SSDB
Motif
Pfam: MHC_II_beta C1-set Ig_2 Ig_3 C2-set_2 I-set ig
Other DBs
NCBI-GeneID: 15000
NCBI-ProteinID: NP_034518
MGI: 95923
Ensembl: ENSMUSG00000037548
Vega: OTTMUSG00000037091
UniProt: Q31099
Structure
PDB: 
1K8I

Position
17 B1; 17 17.98 cM
AA seq 261 aa
MAALWLLLLVLSLHCMGAGGFVAHVESTCVLNDAGTPQDFTYCVSFNKDLLACWDPDVGK
IVPCEFGVLSRLAEIISNILNEQESLIHRLQNGLQDCATHTQPFWDVLTHRTRAPSVRVA
QTTPFNTREPVMLACYVWGFYPADVTITWMKNGQLVPSHSNKEKTAQPNGDWTYQTVSYL
ALTPSYGDVYTCVVQHSGTSEPIRGDWTPGLSPIQTVKVSVSAATLGLGFIIFCVGFFRW
RKSHSSSYTPLPGSTYPEGRH
NT seq 786 nt   +upstreamnt  +downstreamnt
atggctgcactctggctgctgctgctggtcctcagtctgcactgtatgggggcaggtggc
tttgtggctcatgtggaaagcacgtgcgtgctgaatgatgctgggaccccacaggacttc
acatactgtgtttccttcaacaaagatctgctggcctgctgggatccagatgtgggaaaa
atagtcccctgtgaatttggggtgctgtctagattggctgaaataatttcaaatatcctc
aacgaacaggagagccttattcatcgcttgcaaaacgggcttcaggactgtgccacccac
acccaacctttctgggatgtgctgacccacagaacgagagcgccatctgtccgagtagcc
caaaccacaccttttaacacaagggagcccgtgatgctggcctgctacgtctggggcttc
tatccagcggatgtgaccatcacatggatgaagaatgggcagcttgtcccttcccacagc
aacaaggagaagacggctcagcccaatggagactggacataccagacagtctcctaccta
gccctaaccccttcctacggggacgtctacacctgcgtggttcagcacagcgggacctct
gagcccatccgcggggactggacacctgggctgtcccccatccagacagtgaaggtctct
gtgtctgcagccaccctgggcctgggcttcatcatcttctgtgttggcttcttcagatgg
cgcaagtctcattcctccagctacactcctctccccggatccacctacccagaaggacgg
cactag

KEGG   Mus musculus (mouse): 15001
Entry
15001             CDS       T01002                                 

Gene name
H2-Oa, H-2, H-2Oa
Definition
(RefSeq) histocompatibility 2, O region alpha locus
  KO
K06752  MHC class II antigen
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04145  Phagosome
mmu04514  Cell adhesion molecules
mmu04612  Antigen processing and presentation
mmu04640  Hematopoietic cell lineage
mmu04658  Th1 and Th2 cell differentiation
mmu04659  Th17 cell differentiation
mmu04672  Intestinal immune network for IgA production
mmu04940  Type I diabetes mellitus
mmu05140  Leishmaniasis
mmu05145  Toxoplasmosis
mmu05150  Staphylococcus aureus infection
mmu05152  Tuberculosis
mmu05164  Influenza A
mmu05166  Human T-cell leukemia virus 1 infection
mmu05168  Herpes simplex virus 1 infection
mmu05169  Epstein-Barr virus infection
mmu05310  Asthma
mmu05320  Autoimmune thyroid disease
mmu05321  Inflammatory bowel disease
mmu05322  Systemic lupus erythematosus
mmu05323  Rheumatoid arthritis
mmu05330  Allograft rejection
mmu05332  Graft-versus-host disease
mmu05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    15001 (H2-Oa)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    15001 (H2-Oa)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    15001 (H2-Oa)
   04612 Antigen processing and presentation
    15001 (H2-Oa)
   04658 Th1 and Th2 cell differentiation
    15001 (H2-Oa)
   04659 Th17 cell differentiation
    15001 (H2-Oa)
   04672 Intestinal immune network for IgA production
    15001 (H2-Oa)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    15001 (H2-Oa)
   05164 Influenza A
    15001 (H2-Oa)
   05168 Herpes simplex virus 1 infection
    15001 (H2-Oa)
   05169 Epstein-Barr virus infection
    15001 (H2-Oa)
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    15001 (H2-Oa)
   05152 Tuberculosis
    15001 (H2-Oa)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    15001 (H2-Oa)
   05140 Leishmaniasis
    15001 (H2-Oa)
  09163 Immune disease
   05310 Asthma
    15001 (H2-Oa)
   05322 Systemic lupus erythematosus
    15001 (H2-Oa)
   05323 Rheumatoid arthritis
    15001 (H2-Oa)
   05320 Autoimmune thyroid disease
    15001 (H2-Oa)
   05321 Inflammatory bowel disease
    15001 (H2-Oa)
   05330 Allograft rejection
    15001 (H2-Oa)
   05332 Graft-versus-host disease
    15001 (H2-Oa)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    15001 (H2-Oa)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    15001 (H2-Oa)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    15001 (H2-Oa)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   15001 (H2-Oa)
  Exosomal proteins of epithelial cells
   15001 (H2-Oa)
  Exosomal proteins of breast milk
   15001 (H2-Oa)
SSDB
Motif
Pfam: MHC_II_alpha C1-set Ig_3 Marek_A Ig_2 C2-set_2
Other DBs
NCBI-GeneID: 15001
NCBI-ProteinID: NP_032232
MGI: 95924
Ensembl: ENSMUSG00000024334
Vega: OTTMUSG00000037090
UniProt: B2RST7 Q9QWV1
Position
17 B1; 17 17.98 cM
AA seq 250 aa
MVLFVELVPVLLTAMSFLSPRGVRAIKADHMGSYGPAFYQSYDASGQFTHEFDGEQIFSV
DLKNEEVVWRLPEFGDFAHSDFQSGLMSISMIKAHLDILVERSNRTRAVSVPPRVTVLPK
TRVELGKPNVLICIVDDIFPPVINVTWLRNSQPITKGVAQTSFYSQPNHRFRKFHYLTFV
PSAEDVYDCKVEHWGLDTPLLQHWEPQVLTPPPDTIETLICGLGLVLGLMGCLLGTVLMI
TGTRRPSIRR
NT seq 753 nt   +upstreamnt  +downstreamnt
atggtcctttttgtggagctggtcccggtactcctaaccgcaatgagcttcctgagtccc
cgaggagtaagggccatcaaggccgaccacatgggctcctatggaccggccttctaccaa
tcttacgacgcttctggacagttcacacacgaatttgacggggaacaaattttctccgtg
gatctgaagaacgaggaggtcgtgtggcgtctgcctgagtttggagacttcgcccactcg
gactttcagagtgggctgatgagcatttccatgatcaaagctcatctggacatcttggtg
gaacgctccaaccgaaccagagctgtcagcgtgcctcccagagtgaccgttctccccaag
actcgtgtggagctcggaaagcccaacgtcctcatctgcatcgtggatgatatcttcccg
cctgtgatcaatgtcacctggctgcgcaacagccagcccatcactaagggagtggcccag
accagcttctactctcagcctaaccacaggttccggaagttccactacctgaccttcgtg
ccctctgcggaggatgtgtacgactgcaaggtggaacactggggcctggatacaccgctc
ctccagcactgggagccccaagtgcttaccccaccaccggacaccatagagaccctgatc
tgtggcctgggcctggttctcggccttatgggctgcctcctgggcaccgtgctcatgatc
acaggcacacgcaggcccagtatccgcaggtaa

KEGG   Mus musculus (mouse): 15002
Entry
15002             CDS       T01002                                 

Gene name
H2-Ob, A-bet, A-beta, A-beta-2, A-beta2, H-2, H-2Ab, H-2I, H-2O, H-2Ob, H2-A, H2-Ab, H2-Ab2, H2-IA, H2-IAb2, O, Ob, vi, vic1
Definition
(RefSeq) histocompatibility 2, O region beta locus
  KO
K06752  MHC class II antigen
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04145  Phagosome
mmu04514  Cell adhesion molecules
mmu04612  Antigen processing and presentation
mmu04640  Hematopoietic cell lineage
mmu04658  Th1 and Th2 cell differentiation
mmu04659  Th17 cell differentiation
mmu04672  Intestinal immune network for IgA production
mmu04940  Type I diabetes mellitus
mmu05140  Leishmaniasis
mmu05145  Toxoplasmosis
mmu05150  Staphylococcus aureus infection
mmu05152  Tuberculosis
mmu05164  Influenza A
mmu05166  Human T-cell leukemia virus 1 infection
mmu05168  Herpes simplex virus 1 infection
mmu05169  Epstein-Barr virus infection
mmu05310  Asthma
mmu05320  Autoimmune thyroid disease
mmu05321  Inflammatory bowel disease
mmu05322  Systemic lupus erythematosus
mmu05323  Rheumatoid arthritis
mmu05330  Allograft rejection
mmu05332  Graft-versus-host disease
mmu05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    15002 (H2-Ob)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    15002 (H2-Ob)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    15002 (H2-Ob)
   04612 Antigen processing and presentation
    15002 (H2-Ob)
   04658 Th1 and Th2 cell differentiation
    15002 (H2-Ob)
   04659 Th17 cell differentiation
    15002 (H2-Ob)
   04672 Intestinal immune network for IgA production
    15002 (H2-Ob)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    15002 (H2-Ob)
   05164 Influenza A
    15002 (H2-Ob)
   05168 Herpes simplex virus 1 infection
    15002 (H2-Ob)
   05169 Epstein-Barr virus infection
    15002 (H2-Ob)
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    15002 (H2-Ob)
   05152 Tuberculosis
    15002 (H2-Ob)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    15002 (H2-Ob)
   05140 Leishmaniasis
    15002 (H2-Ob)
  09163 Immune disease
   05310 Asthma
    15002 (H2-Ob)
   05322 Systemic lupus erythematosus
    15002 (H2-Ob)
   05323 Rheumatoid arthritis
    15002 (H2-Ob)
   05320 Autoimmune thyroid disease
    15002 (H2-Ob)
   05321 Inflammatory bowel disease
    15002 (H2-Ob)
   05330 Allograft rejection
    15002 (H2-Ob)
   05332 Graft-versus-host disease
    15002 (H2-Ob)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    15002 (H2-Ob)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    15002 (H2-Ob)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    15002 (H2-Ob)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   15002 (H2-Ob)
  Exosomal proteins of epithelial cells
   15002 (H2-Ob)
  Exosomal proteins of breast milk
   15002 (H2-Ob)
SSDB
Motif
Pfam: MHC_II_beta C1-set Ig_3 DUF1538 C2-set_2 MHC_I
Other DBs
NCBI-GeneID: 15002
NCBI-ProteinID: NP_034519
MGI: 95925
Ensembl: ENSMUSG00000041538
Vega: OTTMUSG00000037093
UniProt: Q3U1X7 O35424
Position
17 B1; 17 17.98 cM
AA seq 271 aa
MGAGRAPWVVALLVNLMRLDSFMIEGRDSPENFVIQAKADCYFTNGTEKVHLLVRFIFNL
EEYLHFDSDLGMFVALTELGEPDADQWNKRLDLLETSRAAVNMVCRQKYKLGAPFTVERN
VPPEVTVYPERTPLLQQHNLLLCSVTGFYPGDISVKWFRNGQEERSGVMSTGLVRNGDWT
FQTTVMLEMIPELGDIYSCLVEHPGLLRPVSVAWMAQSEYSWKKILSGAAVFLLGLIVFL
VGVVIHLKAQKASVETQPGNEASRESLHSQP
NT seq 816 nt   +upstreamnt  +downstreamnt
atgggcgctgggagggccccctgggtggtggctctgttggtgaacctcatgaggctggat
tccttcatgattgaaggcagagactccccagagaattttgtgattcaggcaaaggcggac
tgttacttcaccaatggtacagaaaaggttcacttgctggtcaggttcatcttcaacctg
gaggagtatttacacttcgacagtgacctggggatgtttgtggctctgacggagctgggg
gaacctgatgctgaccagtggaacaaacgcctggatctcctggagacgagcagagctgct
gtgaacatggtctgcaggcagaagtacaagctgggggcccccttcactgtggagagaaat
gtgcctccagaggtgacagtgtatccagagaggaccccgttgctgcagcagcacaacctg
ctgctctgctctgtgacaggcttctaccccggggacataagtgtcaagtggttccggaat
ggacaggaggagaggtctggggtcatgtccactggccttgttaggaatggagactggacc
ttccagacaacagtaatgctggaaatgatcccagagcttggtgacatctacagctgcctc
gtggagcaccccggcctcctgagacctgtttctgtggcatggatggctcagtctgaatat
tcctggaaaaagatactgagtggagctgcagtgttcctgcttgggctgattgtcttcctg
gtgggggttgttatccatctcaaggctcagaaagcatctgtggagactcagcctggcaat
gaggcctcaagagagagtctccattctcaaccctag

KEGG   Mus musculus (mouse): 381091
Entry
381091            CDS       T01002                                 

Gene name
H2-Eb2, A130038H09Rik, H-2Eb2, I, Ia, Ia-5, Ia5, Iebeta2
Definition
(RefSeq) histocompatibility 2, class II antigen E beta2
  KO
K06752  MHC class II antigen
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04145  Phagosome
mmu04514  Cell adhesion molecules
mmu04612  Antigen processing and presentation
mmu04640  Hematopoietic cell lineage
mmu04658  Th1 and Th2 cell differentiation
mmu04659  Th17 cell differentiation
mmu04672  Intestinal immune network for IgA production
mmu04940  Type I diabetes mellitus
mmu05140  Leishmaniasis
mmu05145  Toxoplasmosis
mmu05150  Staphylococcus aureus infection
mmu05152  Tuberculosis
mmu05164  Influenza A
mmu05166  Human T-cell leukemia virus 1 infection
mmu05168  Herpes simplex virus 1 infection
mmu05169  Epstein-Barr virus infection
mmu05310  Asthma
mmu05320  Autoimmune thyroid disease
mmu05321  Inflammatory bowel disease
mmu05322  Systemic lupus erythematosus
mmu05323  Rheumatoid arthritis
mmu05330  Allograft rejection
mmu05332  Graft-versus-host disease
mmu05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    381091 (H2-Eb2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    381091 (H2-Eb2)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    381091 (H2-Eb2)
   04612 Antigen processing and presentation
    381091 (H2-Eb2)
   04658 Th1 and Th2 cell differentiation
    381091 (H2-Eb2)
   04659 Th17 cell differentiation
    381091 (H2-Eb2)
   04672 Intestinal immune network for IgA production
    381091 (H2-Eb2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    381091 (H2-Eb2)
   05164 Influenza A
    381091 (H2-Eb2)
   05168 Herpes simplex virus 1 infection
    381091 (H2-Eb2)
   05169 Epstein-Barr virus infection
    381091 (H2-Eb2)
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    381091 (H2-Eb2)
   05152 Tuberculosis
    381091 (H2-Eb2)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    381091 (H2-Eb2)
   05140 Leishmaniasis
    381091 (H2-Eb2)
  09163 Immune disease
   05310 Asthma
    381091 (H2-Eb2)
   05322 Systemic lupus erythematosus
    381091 (H2-Eb2)
   05323 Rheumatoid arthritis
    381091 (H2-Eb2)
   05320 Autoimmune thyroid disease
    381091 (H2-Eb2)
   05321 Inflammatory bowel disease
    381091 (H2-Eb2)
   05330 Allograft rejection
    381091 (H2-Eb2)
   05332 Graft-versus-host disease
    381091 (H2-Eb2)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    381091 (H2-Eb2)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    381091 (H2-Eb2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    381091 (H2-Eb2)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   381091 (H2-Eb2)
  Exosomal proteins of epithelial cells
   381091 (H2-Eb2)
  Exosomal proteins of breast milk
   381091 (H2-Eb2)
SSDB
Motif
Pfam: MHC_II_beta C1-set Ig_3 ig YtpI Tricorn_C1 DUF5668
Other DBs
NCBI-GeneID: 381091
NCBI-ProteinID: NP_001029150
MGI: 95902
Ensembl: ENSMUSG00000067341
Vega: OTTMUSG00000020169
UniProt: Q3UUV9
Position
17 B1; 17 17.98 cM
AA seq 287 aa
MVSLWLPRGLCVAAVILSLMMLTPPVILVRDPRPRFLEQLKAECHYFNGKERVWSVTRFI
YNQEEFARFNSDFGKFLAVTELGRPIVEYLNTQKDMLDNYRASVDRCRNNYDLVDIFMLN
LKAEPKVTVYPAKTQPLEHHNLLVCSVIDFYPGSIEVRWFRNGEEEKTGVVSTGLIQNRD
WTYQTLVMLEMVPRGGEVYTCQVEHPSLTSPVTVEWRARSTSAQNKLLSGVMGMALGLFI
LAVGLFFYLRNLRAGSVSHGAGEGAESFTSRLTGSGSECHMGPGLSI
NT seq 864 nt   +upstreamnt  +downstreamnt
atggtgtctctgtggctccccagaggcctctgtgtggcagctgtgatcctgagtctgatg
atgctgacccctccggtgattttagtcagggacccacgaccacgttttctggagcagttg
aaggctgagtgtcactacttcaatgggaaggagcgtgtgtggagtgtgaccagattcatc
tataaccaggaagagtttgcccgctttaacagtgactttgggaagttcctggcagtgact
gagctggggcggcccatagttgagtacttgaacacccagaaggacatgctggacaattat
cgtgcctcagtagacaggtgcagaaataactatgaccttgtggatatcttcatgttgaac
ttaaaagctgagcccaaggtgactgtgtaccctgcaaagacacagcctctggaacaccat
aacctcctggtctgctctgtgattgacttctaccctggcagcattgaagtcagatggttc
cggaatggcgaggaggagaagactggagttgtgtccactggactgatccaaaatagagac
tggacctaccagaccctggtgatgctggagatggttcctcggggtggagaggtttacacc
tgccaggtggagcatcccagcctgaccagccctgtcacagtggagtggagggctcggtcc
acatctgcacagaacaagttgttgagcggagtcatgggcatggcgctaggtctgttcatc
ctcgcagtggggctgttcttctatttaaggaatctgagagcaggatcagtgtctcatggt
gctggtgaaggagctgaaagtttcacatccagattgacaggcagtgggagtgaatgccac
atggggcctgggttgagcatctga

DBGET integrated database retrieval system