KEGG   Mus musculus (house mouse): 104245
Entry
104245            CDS       T01002                                 
Symbol
Slc6a5, Glyt2, prestin
Name
(RefSeq) solute carrier family 6 (neurotransmitter transporter, glycine), member 5
  KO
K05038  solute carrier family 6 (neurotransmitter transporter, glycine) member 5/9
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04721  Synaptic vesicle cycle
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09156 Nervous system
   04721 Synaptic vesicle cycle
    104245 (Slc6a5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    104245 (Slc6a5)
Transporters [BR:mmu02000]
 Solute carrier family (SLC)
  SLC6: Sodium- and chloride-dependent neurotransmitter transporter
   104245 (Slc6a5)
SSDB
Motif
Pfam: SNF DUF999
Other DBs
NCBI-GeneID: 104245
NCBI-ProteinID: NP_001139485
MGI: 105090
Ensembl: ENSMUSG00000039728
Vega: OTTMUSG00000059001
UniProt: B2RQX9 B2RXV9
Position
7:49556733..49613612
AA seq 799 aa
MDCSAPKEMNKQPANILEAAVPGHRDSPRAPRTSPEQDLPAEAPTATVQPPRVPRSASTG
AQTFQSADARACEAQQSGVGFCNLSSPRAQATSAALRDLSEGHSAQANPPSGPAGAGNAL
HCKIPALRGPEEDANVSVGKGTLEHNNTPAVGWVNMSQSTVVLGTDGIASVLPGSVATTT
IPEDEQGDENKARGNWSSKLDFILSMVGYAVGLGNVWRFPYLAFQNGGGAFLIPYLMMLA
LAGLPIFFLEVSLGQFASQGPVSVWKAIPALQGCGIAMLIISVLIAIYYNVIICYTLFYL
FASFVSVLPWGSCNNPWNTPECKDKTKLLLDSCVIGDHPKIQIKNSTFCMTAYPNLTMVN
FTSQTNKTFVSGSEEYFKYFVLKISAGIEYPGEIRWPLAFCLFLAWVIVYASLAKGIKSS
GKVVYFTATFPYVVLVILLIRGVTLPGAGAGIWYFITPKWEKLTDATVWKDAATQIFFSL
SAAWGGLITLSSYNKFHNNCYRDTLIVTCTNSATSIFAGFVIFSVIGFMANERKVNIENV
ADQGPGIAFVVYPEALTRLPLSPFWAIIFFLMLLTLGLDTMFATIETIVTSISDEFPKYL
RTHKPVFTLGCCICFFIMGFPMITQGGIYMFQLVDTYAASYALVIIAIFELVGISYVYGL
QRFCEDIEMMIGFKPNIFWKVCWAFVTPTILTFILCFSFYQWEPMTYGSYRYPNWSMVLG
WLMLACSVIWIPIMFVIKMYLAPGRFIERLKLVCSPQPDWGPFLAQHRGERYKNMIDPLG
TSSLGLKLPVKDLELGTQC
NT seq 2400 nt   +upstreamnt  +downstreamnt
atggattgcagtgctcccaaggaaatgaataaacagccagccaacatcttggaggcagcg
gtgccaggccaccgggatagtcctcgtgcacctaggaccagccctgaacaggatcttcct
gctgaggcccccacggccactgtccagccgccacgtgtgcccaggtcggcttccaccggc
gcccaaactttccagtctgcggatgcgagagcctgcgaggcccagcagtccggagtaggg
ttttgtaatctcagcagcccccgggcacaagcgacctccgcggccctccgggacttaagc
gaagggcacagcgcacaggccaatcccccttccgggcccgccggggctggcaacgctctg
cactgcaagattccagctctgcgtggcccggaggaggacgcgaacgtgagtgtgggcaag
ggcacgctggagcacaacaataccccagccgtgggctgggtgaatatgagccagagcaca
gtagtgttgggaaccgatggcatcgcgtcggtgctcccgggcagcgtggccaccactacc
ataccggaggacgagcaaggggatgagaataaggcccgagggaactggtccagcaaactg
gacttcatcctgtccatggtggggtacgcagtggggctgggcaatgtttggaggtttccc
tacctggccttccagaacgggggaggcgcgttcctcatcccttacttgatgatgctggca
ctggctggcttacccatcttcttcctagaggtgtccctgggccagtttgccagccagggt
cctgtgtctgtgtggaaggccatcccagctctgcagggttgtggcattgcgatgctcatc
atctctgtcctcatagccatatactacaacgtcatcatctgctacacgctcttctacctg
tttgcctccttcgtgtctgtgctgccctgggggtcctgcaacaacccgtggaacacacca
gaatgcaaagataaaaccaaacttttactagattcctgtgttatcggtgaccatcccaag
atacagatcaagaactctactttctgcatgactgcctatccgaacttgacaatggttaac
ttcaccagccagaccaataagacatttgtcagcgggagtgaagagtacttcaagtatttt
gtgctgaagatttctgcagggattgaatatccgggtgagatccggtggcccttggccttc
tgccttttcttggcttgggtgattgtgtacgcatcactggcgaaaggaattaagtcatca
ggaaaagtagtctacttcacagccacattcccttatgtcgtcctggtcatcctccttatt
cgaggagtcaccctgcctggagctggagccggcatctggtacttcatcacacctaagtgg
gaaaaactcacggatgccacggtatggaaggatgcggccactcagattttcttctccctg
tctgcggcctggggagggctcatcactctttcttcttacaacaaattccacaacaactgc
tacagggatacgttaattgtaacctgcactaacagtgccactagcatctttgctgggttt
gtcatcttctctgtcatcggcttcatggccaacgagcgcaaagtcaacattgagaatgtg
gccgaccaagggcctggcattgcatttgtggtttaccctgaggccttaactaggctgcct
ctctctccattctgggccatcatcttttttctgatgcttctcacgcttggactcgacacc
atgtttgccaccattgagaccatcgtgacctccatctcggatgagtttcccaagtacctg
cgcacacacaagcctgtgttcaccctgggctgctgcatctgcttcttcattatgggcttc
cctatgatcacacagggtggaatctacatgtttcagcttgtggacacctacgctgcctcc
tatgcccttgtcatcattgccatatttgagcttgttggcatctcctatgtgtatggcttg
cagagattctgtgaagacatcgagatgatgattggattcaagcccaacattttctggaaa
gtctgctgggcattcgtcacaccgaccattttgacttttatcctttgcttcagcttctac
cagtgggagcccatgacctatggctcttaccgctaccctaactggtccatggtgcttgga
tggctgatgctcgcctgctccgttatctggatcccgattatgttcgtgataaaaatgtat
ctggctcccgggagatttattgagaggctgaagttggtatgctcgccacagcccgactgg
ggcccattcttagctcagcaccgcggggaacgctacaagaatatgatcgaccccttggga
acttcgtcgctgggactcaagctgcccgtgaaggatttggaactgggcactcagtgctag

KEGG   Mus musculus (house mouse): 13162
Entry
13162             CDS       T01002                                 
Symbol
Slc6a3, DAT, Dat1
Name
(RefSeq) solute carrier family 6 (neurotransmitter transporter, dopamine), member 3
  KO
K05036  solute carrier family 6 (neurotransmitter transporter, dopamine) member 3
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04721  Synaptic vesicle cycle
mmu04728  Dopaminergic synapse
mmu05012  Parkinson disease
mmu05022  Pathways of neurodegeneration - multiple diseases
mmu05030  Cocaine addiction
mmu05031  Amphetamine addiction
mmu05034  Alcoholism
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09156 Nervous system
   04728 Dopaminergic synapse
    13162 (Slc6a3)
   04721 Synaptic vesicle cycle
    13162 (Slc6a3)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05012 Parkinson disease
    13162 (Slc6a3)
   05022 Pathways of neurodegeneration - multiple diseases
    13162 (Slc6a3)
  09165 Substance dependence
   05030 Cocaine addiction
    13162 (Slc6a3)
   05031 Amphetamine addiction
    13162 (Slc6a3)
   05034 Alcoholism
    13162 (Slc6a3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    13162 (Slc6a3)
Transporters [BR:mmu02000]
 Solute carrier family (SLC)
  SLC6: Sodium- and chloride-dependent neurotransmitter transporter
   13162 (Slc6a3)
SSDB
Motif
Pfam: SNF
Other DBs
NCBI-GeneID: 13162
NCBI-ProteinID: NP_034150
MGI: 94862
Ensembl: ENSMUSG00000021609
UniProt: Q61327
Position
13:73684270..73726791
AA seq 619 aa
MSKSKCSVGPMSSVVAPAKEPNAVGPREVELILVKEQNGVQLTNSTLINPPQTPVEVQER
ETWSKKIDFLLSVIGFAVDLANVWRFPYLCYKNGGGAFLVPYLLFMVIAGMPLFYMELAL
GQFNREGAAGVWKICPVLKGVGFTVILISFYVGFFYNVIIAWALHYFFSSFTMDLPWIHC
NNTWNSPNCSDAHSSNSSDGLGLNDTFGTTPAAEYFERGVLHLHQSRGIDDLGPPRWQLT
ACLVLVIVLLYFSLWKGVKTSGKVVWITATMPYVVLTALLLRGVTLPGAMDGIRAYLSVD
FYRLCEASVWIDAATQVCFSLGVGFGVLIAFSSYNKFTNNCYRDAIITTSINSLTSFSSG
FVVFSFLGYMAQKHNVPIRDVATDGPGLIFIIYPEAIATLPLSSAWAAVFFLMLLTLGID
SAMGGMESVITGLVDEFQLLHRHRELFTLGIVLATFLLSLFCVTNGGIYVFTLLDHFAAG
TSILFGVLIEAIGVAWFYGVQQFSDDIKQMTGQRPNLYWRLCWKLVSPCFLLYVVVVSIV
TFRPPHYGAYIFPDWANALGWIIATSSMAMVPIYATYKFCSLPGSFREKLAYAITPEKDR
QLVDRGEVRQFTLRHWLLV
NT seq 1860 nt   +upstreamnt  +downstreamnt
atgagtaaaagcaaatgctccgtgggaccaatgtcttctgtggtggccccggctaaagag
cccaatgctgtgggccccagagaggtggagctcatcttggtcaaggagcagaatggagtg
cagctgaccaactccaccctcatcaacccaccgcagacaccagtggaggttcaagagcgg
gagacctggagcaagaaaatcgatttcctgctctcagtcatcggcttcgctgtggacctg
gccaatgtctggaggtttccctacctgtgctacaaaaatggtggaggtgccttcctggtg
ccctacctgctcttcatggttattgccgggatgcccctcttctacatggagctggctctc
gggcagttcaacagagaaggagctgctggtgtctggaagatctgccctgtcctgaaaggt
gtgggcttcactgtcatcctcatctctttctacgtgggcttcttctacaatgtcatcatt
gcatgggcactgcactacttcttctcctccttcaccatggacctcccatggatccactgc
aacaacacctggaacagccccaactgctctgatgcacatagcagcaactctagcgatggc
ctgggcctcaacgacacctttgggaccacacccgctgctgagtattttgagcgtggtgtg
ctgcacctccatcagagtcgtggcattgatgacctgggccctccacggtggcagctcaca
gcctgcctggtgctggtcattgttctgctctacttcagcctgtggaagggagtaaagact
tcagggaaggtggtgtggatcacagctaccatgccctatgtagtcctcacagccctgctc
ctgcgtggagtcaccctccctggggccatggatggcatcagagcatacctcagtgtggac
ttctaccgtctctgtgaggcatctgtgtggatcgatgccgccacccaggtgtgcttctcc
cttggcgttgggtttggggtgctgattgccttctccagttacaataagttcaccaataac
tgctatagagatgcaatcatcaccacctccattaactccctgacgagcttctcctctggc
ttcgttgtcttctccttcctggggtacatggcacagaagcacaatgtgcccatcagggat
gtggccacagatggacctgggttgatcttcatcatctaccctgaggcaatcgccacactc
ccgctgtcttcagcctgggccgctgtcttcttcctcatgctgctcactctgggtatcgac
agtgccatggggggcatggagtctgtgatcactgggcttgtcgatgagttccagctgcta
catcggcatcgagagctcttcactcttggcattgtcctggctactttcctgctgtctctc
ttctgtgtcaccaacggtggcatctatgtcttcacactgctggaccactttgcagctggc
acatctatcctctttggagtgctcattgaagccattggggtggcctggttctacggtgtc
cagcaattcagtgatgacatcaagcagatgactgggcagcgacccaacctgtactggcgg
ctatgctggaagctggtcagcccctgcttccttctgtatgtggtcgtggtcagcattgtg
accttcagacccccacactatggagcctacatcttcccagactgggccaatgccctgggc
tggatcattgccacatcctccatggccatggtgcccatttatgccacctataagttctgc
agcctgccagggtccttccgagagaaactggcctatgccatcacacctgagaaagaccgc
cagctagtggacagaggggaggtgcgccaattcacgctgcgccattggctgttggtgtaa

KEGG   Mus musculus (house mouse): 14411
Entry
14411             CDS       T01002                                 
Symbol
Slc6a12, BGT1, GAT-2, GAT2, Gabt2
Name
(RefSeq) solute carrier family 6 (neurotransmitter transporter, betaine/GABA), member 12
  KO
K05045  solute carrier family 6 (neurotransmitter transporter, betaine/GABA) member 12
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04721  Synaptic vesicle cycle
mmu04727  GABAergic synapse
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09156 Nervous system
   04727 GABAergic synapse
    14411 (Slc6a12)
   04721 Synaptic vesicle cycle
    14411 (Slc6a12)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    14411 (Slc6a12)
Transporters [BR:mmu02000]
 Solute carrier family (SLC)
  SLC6: Sodium- and chloride-dependent neurotransmitter transporter
   14411 (Slc6a12)
SSDB
Motif
Pfam: SNF
Other DBs
NCBI-GeneID: 14411
NCBI-ProteinID: NP_001334362
MGI: 95628
Ensembl: ENSMUSG00000030109
Vega: OTTMUSG00000036447
UniProt: G5E8Z4
Position
6:121319533..121342732
AA seq 614 aa
MDRKVAVHEDGYPVVSWVPEEGEMMDQKGKDQVKDRGQWTNKMEFVLSVAGEIIGLGNVW
RFPYLCYKNGGGAFFIPYFIFFFSCGIPVFFLEVALGQYSSQGSVTAWRKICPLLQGIGM
ASVVIESYLNIYYIIILAWALFYLFSSFTWELPWTTCTNSWNTEHCVDFLNHSSARGVSS
SENFTSPVMEFWERRVLGITSGIHDLGSLRWELALCLLLAWIICYFCIWKGVKSTGKVVY
FTATFPYLMLIILLIRGVTLPGAYQGIVFYLKPDLLRLKDPQVWMDAGTQIFFSFAICQG
CLTALGSYNKYHNNCYRDSIALCFLNSATSFVAGFVVFSILGFMSQEQGIPISEVAESGP
GLAFIAFPKAVTMMPLSQLWSCLFFIMLLFLGLDSQFVCMECLVTASMDMFPQQLRKSGR
RELLILAISVLCYLMGLLLVTEGGMYIFQLFDYYASSGICLLFLSLFEVICIGWVYGADR
FYDNVEDMIGYRPWPLVKISWLFLTPGLCLATFFFSLSKYTPLKYNNVYMYPSWGYSIGW
LLAFSSMACVPLFIIITFLKTQGSFKKRLRRLITPDPSLPQPGRRPPQDGSSAQNCSSSP
AKQELIAWEKETHL
NT seq 1845 nt   +upstreamnt  +downstreamnt
atggacaggaaggttgcagtccatgaagatggctatcctgtggtctcttgggtccctgag
gaaggagagatgatggaccagaaaggcaaggaccaggtgaaggatcgtggccaatggacc
aacaagatggagtttgtgctgtcagtggctggagagatcattggcttaggcaacgtctgg
aggtttccctatctctgctacaagaatggaggtggagctttcttcatcccctacttcatc
ttcttcttcagctgtggcatcccagtgttcttcctggaggtggcactgggccagtatagc
agccaggggagtgtgactgcttggaggaagatctgtcccctcctccaaggcattggcatg
gcctctgtggtcatcgagtcttatttgaacatctactacattatcatccttgcctgggct
ctcttctacctgttcagctccttcacctgggagcttccctggacaacctgcaccaactcg
tggaacacagagcactgcgtggactttctgaatcactcatcggccagaggagtgagctct
tctgagaactttacctcgcctgtcatggaattctgggagagacgggttttgggtattaca
tcgggcatccacgacctggggtccctgcgttgggagctggccttgtgcctcctgcttgcc
tggattatctgctacttctgcatctggaagggggtcaagtccacaggcaaggttgtttac
ttcacagccacttttccctacctgatgctgattattcttctgatccggggtgtcaccctt
cctggagcctaccagggcatcgtcttctacctgaagccagacttgctccgtctcaaggac
ccccaggtgtggatggatgcgggcacccagatcttcttttcctttgccatctgccagggg
tgcctgacagccctgggcagctacaacaagtaccacaacaactgctacagggactccatc
gccctctgcttcctgaacagtgctaccagcttcgtggctgggtttgttgtcttctccatc
ttgggcttcatgtctcaggagcagggaatacccatttctgaagtggctgagtcaggtcct
gggctggccttcattgccttccccaaagctgtcaccatgatgcctttgtcccagctgtgg
tcctgcctcttcttcatcatgctcctgtttctagggctggacagccagttcgtctgtatg
gagtgcctggtgaccgcttccatggatatgttccctcagcagctccgaaagagtggccgg
cgggagctgctgatcctcgctatctctgttttgtgctacttgatggggctccttttggtc
acagagggcgggatgtatatcttccagctctttgactactacgcctccagcggcatatgc
ctactcttcctctccttgtttgaggtgatctgcattggctgggtgtatggggccgaccgt
ttctatgacaacgtggaagacatgattggctatcggccatggcccttggtgaagatctcc
tggctcttcctgactcctggcctttgcctggccactttcttcttctccttgagcaagtat
acacctctcaaatacaacaatgtctacatgtatccttcttggggatactccattggatgg
ctcttggctttctcctccatggcctgtgtcccactctttatcatcatcaccttcctgaag
acccagggctccttcaagaagcgtcttcgaagactcatcacaccagaccccagtctgccc
cagccagggcggcgcccaccacaggatggctcctctgctcaaaactgttcgtcctctcca
gccaaacaagaactcattgcctgggagaaggagactcatttgtag

KEGG   Mus musculus (house mouse): 14412
Entry
14412             CDS       T01002                                 
Symbol
Slc6a13, GAT3, Gabt3, Gat2
Name
(RefSeq) solute carrier family 6 (neurotransmitter transporter, GABA), member 13
  KO
K05046  solute carrier family 6 (neurotransmitter transporter, GABA) member 13
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04721  Synaptic vesicle cycle
mmu04727  GABAergic synapse
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09156 Nervous system
   04727 GABAergic synapse
    14412 (Slc6a13)
   04721 Synaptic vesicle cycle
    14412 (Slc6a13)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    14412 (Slc6a13)
Transporters [BR:mmu02000]
 Solute carrier family (SLC)
  SLC6: Sodium- and chloride-dependent neurotransmitter transporter
   14412 (Slc6a13)
SSDB
Motif
Pfam: SNF
Other DBs
NCBI-GeneID: 14412
NCBI-ProteinID: NP_653095
MGI: 95629
Ensembl: ENSMUSG00000030108
Vega: OTTMUSG00000023510
UniProt: P31649
Position
6:121277184..121314680
AA seq 602 aa
MENRASGTTSNGETKPVCPAMEKVEEDGTLEREHWNNKMEFVLSVAGEIIGLGNVWRFPY
LCYKNGGGAFFIPYLIFLFTCGIPVFFLETALGQYTNQGGITAWRRICPIFEGIGYASQM
IVSLLNVYYIVVLAWALFYLFSSFTTDLPWGSCSHEWNTENCVEFQKANDSMNVTSENAT
SPVIEFWERRVLKLSDGIQHLGSLRWELVLCLLLAWIICYFCIWKGVKSTGKVVYFTATF
PYLMLVVLLIRGVTLPGAAQGIQFYLYPNITRLWDPQVWMDAGTQIFFSFAICLGCLTAL
GSYNKYHNNCYRDCIALCILNSSTSFMAGFAIFSILGFMSQEQGVPISEVAESGPGLAFI
AYPRAVVMLPFSPLWACCFFFMVVLLGLDSQFVCVESLVTALVDMYPRVFRKKNRREVLI
LIVSVISFFIGLIMLTEGGMYVFQLFDYYAASGMCLLFVAIFESLCVAWVYGAGRFYDNI
EDMIGYKPWPLIKYCWLFFTPAVCLATFLFSLIKYTPLTYNKKYTYPWWGDALGWLLALS
SMICIPAWSIYKLRTLKGPLRERLRQLVCPAEDLPQKNQPEPTAPATPMTSLLRLTELES
NC
NT seq 1809 nt   +upstreamnt  +downstreamnt
atggagaacagggcctcgggaacaaccagtaatggagagacaaagccagtgtgtccagcc
atggagaaagtggaggaagatggtaccctggaacgggagcactggaacaacaagatggag
tttgtgctgtctgtggctggggagatcattggcttaggcaacgtctggaggtttccctat
ctctgctacaagaacgggggaggtgccttctttatcccctacctcatcttcctttttacc
tgtggcatccctgtcttcttcttggagacagcgcttggccagtacaccaaccagggaggc
atcacagcctggaggagaatctgtcccatctttgaaggcatcggctatgcctcacagatg
atcgtcagcctcctcaatgtctactacatcgttgtcctggcctgggccctcttctacctc
ttcagcagcttcaccactgacctcccctggggaagttgcagccatgagtggaatacagaa
aactgtgtggaattccagaaggccaatgattccatgaatgtgacctccgagaatgccacc
tcccctgtcatcgagttctgggagaggcgagtcctgaagctctcggatggcatccagcac
ctggggtccctgcgctgggaactggtcctgtgcctcctgctcgcctggatcatctgctac
ttctgcatctggaagggggtcaagtccacgggcaaggtggtctacttcacagccactttc
ccttacctcatgctggtggtcctgttgattcgaggagtgacactgcccggagcagcccaa
ggaattcagttttacctgtaccccaacatcacacgtctgtgggatccccaggtgtggatg
gatgcaggcacccagatcttcttctcctttgccatctgtctggggtgcctcacggccctg
ggaagctacaacaagtaccacaacaattgctacagggactgcatcgccctttgcatcctc
aacagcagcaccagcttcatggccgggtttgctatcttctccatcctgggcttcatgtct
caggagcagggtgtgcccatatctgaggttgctgaatcaggccctggcctggcattcatc
gcctaccctcgagctgtggtgatgttacccttctcaccgttgtgggcctgctgtttcttc
ttcatggtcgttctcctgggactagatagccagtttgtgtgtgtagaaagccttgtgaca
gcattagtggacatgtatccccgggtgttccgtaagaagaatcggagggaggtcctcatc
cttattgtgtccgtcatctcgttcttcatcgggctcatcatgctcacagagggcggcatg
tacgtgttccagctctttgactactatgcagccagtggcatgtgtcttctcttcgtggcc
atctttgagtccctctgtgtggcttgggtttatggagccggccgcttctacgacaacatt
gaggatatgattgggtataagccatggcctcttatcaaatattgttggctctttttcacg
ccagctgtgtgcctggcgaccttcctgttctccctgatcaaatacacgccactgacctac
aacaagaagtacacgtacccatggtggggggatgccctagggtggctcctagctctgtcc
tccatgatctgcattcctgcctggagcatctacaagctgaggactctcaagggcccactc
agagagagacttcgccagctcgtgtgcccggctgaagaccttccccagaagaaccaacca
gagccaactgctcctgcgacaccgatgacatcccttctcaggctcacagaactggagtct
aactgctag

KEGG   Mus musculus (house mouse): 14664
Entry
14664             CDS       T01002                                 
Symbol
Slc6a9, Glyt-1, Glyt1
Name
(RefSeq) solute carrier family 6 (neurotransmitter transporter, glycine), member 9
  KO
K05038  solute carrier family 6 (neurotransmitter transporter, glycine) member 5/9
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04721  Synaptic vesicle cycle
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09156 Nervous system
   04721 Synaptic vesicle cycle
    14664 (Slc6a9)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    14664 (Slc6a9)
Transporters [BR:mmu02000]
 Solute carrier family (SLC)
  SLC6: Sodium- and chloride-dependent neurotransmitter transporter
   14664 (Slc6a9)
SSDB
Motif
Pfam: SNF
Other DBs
NCBI-GeneID: 14664
NCBI-ProteinID: NP_032161
MGI: 95760
Ensembl: ENSMUSG00000028542
Vega: OTTMUSG00000008656
UniProt: P28571
Position
4:117692240..117726502
AA seq 633 aa
MVGKGAKGMLNGAVPSEATKKDQNLTRGNWGNQIEFVLTSVGYAVGLGNVWRFPYLCYRN
GGGAFMFPYFIMLIFCGIPLFFMELSFGQFASQGCLGVWRISPMFKGVGYGMMVVSTYIG
IYYNVVICIAFYYFFSSMTHVLPWAYCNNPWNTPDCAGVLDASNLTNGSRPAALSGNLSH
LFNYTLQRTSPSEEYWRLYVLKLSDDIGNFGEVRLPLLGCLGVSWVVVFLCLIRGVKSSG
KVVYFTATFPYVVLTILFVRGVTLEGAFTGIMYYLTPQWDKILEAKVWGDAASQIFYSLG
CAWGGLITMASYNKFHNNCYRDSVIISITNCATSVYAGFVIFSILGFMANHLGVDVSRVA
DHGPGLAFVAYPEALTLLPISPLWSLLFFFMLILLGLGTQFCLLETLVTAIVDEVGNEWI
LQKKTYVTLGVAVAGFLLGIPLTSQAGIYWLLLMDNYAASFSLVVISCIMCVSIMYIYGH
RNYFQDIQMMLGFPPPLFFQICWRFVSPAIIFFILIFTVIQYRPITYNHYQYPGWAVAIG
FLMALSSVICIPLYALFQLCRTDGDTLLQRLKNATKPSRDWGPALLEHRTGRYAPTTTPS
PEDGFEVQPLHPDKAQIPIVGSNGSSRFQDSRI
NT seq 1902 nt   +upstreamnt  +downstreamnt
atggtaggaaaaggtgccaaagggatgttgaatggtgctgtgcccagcgaggccaccaag
aaggaccagaacctcacacggggcaactggggcaaccagatcgagtttgtactgacgagc
gtgggctatgccgtgggcctgggcaatgtctggcgtttcccatacctctgctatcgcaac
gggggaggagccttcatgttcccctacttcatcatgctgatcttctgcgggattcctctc
ttcttcatggagctttccttcggccagtttgcaagccagggctgcctgggggtctggcgg
atcagccccatgttcaaaggcgtgggctatggtatgatggtggtgtccacatacattggc
atctactacaacgtggtcatctgcatcgccttctactacttcttctcgtccatgacgcac
gtgctgccctgggcgtactgcaacaacccctggaacacacctgactgtgccggtgtgctg
gacgcttccaacctcaccaatggctcccggcccgctgccctgtctggcaacctgtctcac
ctgttcaactacaccttgcaaaggaccagccccagcgaggagtactggaggctgtatgtg
ctgaagctgtcagacgacattggaaactttggggaagtgcggcttcccctcctaggctgc
ctcggcgtctcctgggtggttgtcttcctctgtctcatccgaggagtcaagtcttcaggg
aaagtggtgtacttcacggccacattcccctatgtggtgctgaccattctgtttgttcgt
ggagtgaccctggaaggagccttcacgggtatcatgtactacctgaccccacaatgggac
aagatcctggaggccaaggtctggggggatgcagcctctcagatcttctattccctgggc
tgtgcatggggtggcctcatcaccatggcgtcctacaacaaatttcacaacaactgctac
cgggacagcgtcattatcagtatcaccaactgtgctaccagcgtctacgccggcttcgtc
atcttctccatcctgggcttcatggccaatcacctgggtgtggatgtgtctcgggtggca
gaccatgggcctgggctagcttttgtcgcttaccctgaggctctcacgctgcttcccatc
tctccactctggtccttattgtttttcttcatgctcatcttgctggggctgggtactcag
ttctgcctcctagagaccctggtcactgccattgtggatgaggtagggaatgagtggatt
ctgcagaagaagacctacgtgaccttgggcgtcgctgtggctggcttcttgctgggcatc
ccccttaccagccaggcaggcatctactggctgctgctgatggacaactatgcagccagc
ttctccttggttgtcatctcctgtatcatgtgtgtatccatcatgtacatctatgggcac
cgtaactacttccaggacatccagatgatgctaggatttcccccgcctctcttcttccag
atctgttggcgctttgtttctccggctatcatctttttcattctcatcttcacggtgatc
cagtaccggccaatcacctacaaccactaccagtacccaggctgggctgtggccatcggc
ttcctcatggctttgtcgtctgtcatctgcatcccactgtacgcgctgttccagctctgc
cgcacagatggggacacacttcttcagcgtttgaaaaatgccacaaagccaagcagagac
tggggccccgctctcctggagcaccggactgggcgctacgctcccactacaaccccctct
cccgaagacgggtttgaggtccagccactgcacccggacaaggcccagattcccatcgtg
ggcagtaacggctccagccgcttccaggactcccggatatga

KEGG   Mus musculus (house mouse): 15567
Entry
15567             CDS       T01002                                 
Symbol
Slc6a4, 5-HTT, AI323329, Htt, Sert
Name
(RefSeq) solute carrier family 6 (neurotransmitter transporter, serotonin), member 4
  KO
K05037  solute carrier family 6 (neurotransmitter transporter, serotonin) member 4
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04721  Synaptic vesicle cycle
mmu04726  Serotonergic synapse
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09156 Nervous system
   04726 Serotonergic synapse
    15567 (Slc6a4)
   04721 Synaptic vesicle cycle
    15567 (Slc6a4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    15567 (Slc6a4)
Transporters [BR:mmu02000]
 Solute carrier family (SLC)
  SLC6: Sodium- and chloride-dependent neurotransmitter transporter
   15567 (Slc6a4)
SSDB
Motif
Pfam: SNF 5HT_transport_N
Other DBs
NCBI-GeneID: 15567
NCBI-ProteinID: NP_034614
MGI: 96285
Ensembl: ENSMUSG00000020838
Vega: OTTMUSG00000006240
UniProt: Q60857
Position
11:76889423..76923169
AA seq 630 aa
METTPLNSQKVLSECKDKEDCQENGVLQKGVPTPADKAGPGQISNGYSAVPSTSAGDEAP
HSTPAATTTLVAEIHQGERETWGKKMDFLLSVIGYAVDLGNIWRFPYICYQNGGGAFLLP
YTIMAIFGGIPLFYMELALGQYHRNGCISIWKKICPIFKGIGYAICIIAFYIASYYNTII
AWALYYLISSFTDQLPWTSCKNSWNTGNCTNYFAQDNITWTLHSTSPAEEFYLRHVLQIH
QSKGLQDLGTISWQLALCIMLIFTIIYFSIWKGVKTSGKVVWVTATFPYIVLSVLLVRGA
TLPGAWRGVVFYLKPNWQKLLETGVWVDAAAQIFFSLGPGFGVLLAFASYNKFNNNCYQD
ALVTSVVNCMTSFVSGFVIFTVLGYMAEMRNEDVSEVAKDAGPSLLFITYAEAIANMPAS
TFFAIIFFLMLITLGLDSTFAGLEGVITAVLDEFPHIWAKRREWFVLIVVITCILGSLLT
LTSGGAYVVTLLEEYATGPAVLTVALIEAVVVSWFYGITQFCSDVKEMLGFSPGWFWRIC
WVAISPLFLLFIICSFLMSPPQLRLFQYNYPHWSIILGYCIGTSSVICIPIYIIYRLIST
PGTLKERIIKSITPETPTEIPCGDIRMNAV
NT seq 1893 nt   +upstreamnt  +downstreamnt
atggagaccacacctttgaattctcagaaagtgctgtcagagtgtaaggacaaagaggac
tgccaagaaaatggtgttctgcagaagggtgtccccacaccagcagacaaggcagggcct
ggacaaatatccaatgggtactccgcagttcccagtacaagcgctggggatgaagcgcca
cactctacgccagctgccaccaccaccctggtggctgagattcaccaaggggaacgggag
acctggggcaagaagatggatttcctcctgtctgtcattggctatgccgtggacctgggc
aacatctggcgttttccctacatatgctaccagaatggtggaggggccttcctcctccct
tacaccatcatggccatctttggggggatcccactcttctacatggagctcgccctgggc
cagtaccaccgaaatgggtgcatttctatatggaagaagatctgcccgattttcaaaggc
attggctatgccatctgcatcattgccttttatatcgcctcctactataacaccatcata
gcctgggcgctctactacctcatctcctccttcacggaccagctgccctggaccagctgc
aagaactcttggaacactggcaactgcaccaactacttcgcccaggacaacatcacctgg
acactccattccacgtcacctgctgaggagttttacttgcgccatgtcctgcagatccat
cagtcaaagggactccaggacctggggaccatcagctggcagctggctctctgcatcatg
ctcatcttcaccattatctacttcagcatctggaaaggagtcaaaacgtctggcaaggtg
gtgtgggtgacagccaccttcccttacattgtcctttctgtcctgctggtgaggggagcc
acccttcctggagcctggagaggggttgtcttttacttgaaacccaactggcagaaactc
ttggagacaggggtgtgggttgatgctgcggctcagatctttttctctcttggcccgggg
tttggggttctcctggcgtttgctagctacaacaagttcaacaacaactgttaccaagat
gccctggtgaccagtgtggtgaactgcatgacgagcttcgtctctggctttgtcatcttc
acggtgcttggctacatggctgagatgaggaacgaagacgtgtccgaggtggccaaagac
gcgggccccagcctccttttcatcacatatgcggaggcaatagctaacatgccagcatcc
acattctttgccatcatcttcttcctcatgttaatcacgctgggtttggatagtacgttc
gcaggcctggaaggtgtgatcacagctgtgttggatgagtttcctcacatctgggccaag
cgcagggaatggtttgtgctcatcgtggtcatcacttgcatcttgggatccctgctcaca
ctgacatcaggaggggcgtatgtggtgaccctgctggaggagtacgccacggggccagca
gtgctcaccgtggctctcatcgaggccgtcgtcgtgtcttggttctatggaatcactcag
ttctgcagcgacgtgaaggaaatgctgggcttcagccccggatggttttggaggatctgc
tgggtggccatcagccctctgtttctcctgttcatcatttgcagttttttgatgagtcca
ccccaactccggcttttccaatacaattatccccactggagtatcatcttgggctactgc
ataggaacatcgtctgtcatctgcatccctatatacatcatttatcggctgatcagcact
ccagggacacttaaggagcgcattattaaaagtatcactcctgaaacaccaacggaaatt
ccgtgtggggacatccgcatgaatgctgtgtaa

KEGG   Mus musculus (house mouse): 20510
Entry
20510             CDS       T01002                                 
Symbol
Slc1a1, D130048G10Rik, EAAC1, EAAC2, EAAT3, MEAAC1
Name
(RefSeq) solute carrier family 1 (neuronal/epithelial high affinity glutamate transporter, system Xag), member 1
  KO
K05612  solute carrier family 1 (neuronal/epithelial high affinity glutamate transporter), member 1
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04721  Synaptic vesicle cycle
mmu04724  Glutamatergic synapse
mmu04974  Protein digestion and absorption
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09154 Digestive system
   04974 Protein digestion and absorption
    20510 (Slc1a1)
  09156 Nervous system
   04724 Glutamatergic synapse
    20510 (Slc1a1)
   04721 Synaptic vesicle cycle
    20510 (Slc1a1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    20510 (Slc1a1)
Transporters [BR:mmu02000]
 Solute carrier family (SLC)
  SLC1: High-affinity glutamate and neutral amino acid transporter
   20510 (Slc1a1)
SSDB
Motif
Pfam: SDF
Other DBs
NCBI-GeneID: 20510
NCBI-ProteinID: NP_033225
MGI: 105083
Ensembl: ENSMUSG00000024935
Vega: OTTMUSG00000033893
UniProt: P51906
Position
19:28812535..28891360
AA seq 523 aa
MGKPTSSGCDWRRFLRNHWLLLSTVAAVVLGIVLGVVVRGHSELSNLDKFYFAFPGEILM
RMLKLVILPLIVSSMITGVAALDSNVSGKIGLRAVVYYFSTTVIAVILGIVLVVSIKPGV
TQKVNDINRTGKTPEVSTMDAMLDLIRNMFPENLVQACFQQYKTKREEVKPVGDPGGNAT
EVSVTTAMTTMSENKTKEYKIVGLYSDGINVLGLIIFCLVFGLVIGKMGEKGQILVDFFN
ALSDATMKIVQIIMCYMPIGILFLIAGKIIEVEDWEIFRKLGLYMATVLSGLAIHSLIVL
PLLYFIVVRKNPFRFALGMAQALLTALMISSSSATLPVTFRCAEEKNQVDKRITRFVLPV
GATINMDGTALYEAVAAVFIAQLNGLDLSIGQIVTISITATAASIGAAGVPQAGLVTMVI
VLSAVGLPAEDVTLIIAVDWLLDRFRTMVNVLGDAFGTGIVEKLSKKELEQMDVSSEVNI
VNPFALEPTTLDNEDSDTKKSYVNGGFAVDKSDTISFTQTSQF
NT seq 1572 nt   +upstreamnt  +downstreamnt
atggggaagcccacgagctcgggatgtgactggcgccgcttcctacggaatcactggctg
ctgctctccaccgtggccgccgtggtactaggaattgtcttaggagtcgtggttcgagga
cacagtgagctctcaaatctggataaattctactttgcttttcctggggaaattctgatg
aggatgctgaagctggtcattttgccgctgatcgtatccagcatgatcacaggtgtcgct
gcactggattccaatgtgtctgggaagattggtctgcgcgctgtagtatattatttctcc
accaccgtcattgctgtaatcctaggtattgtgttagttgtgagtatcaagcctggtgtc
actcagaaagtgaatgacatcaacaggacgggtaaaacccctgaagtcagcaccatggat
gccatgttggacctgatcaggaacatgttccctgagaatctggtccaagcctgttttcag
cagtacaaaaccaagcgggaagaggtgaagcctgtgggcgatcctggggggaacgcaacg
gaggtgtctgtcaccacagccatgacaacaatgtctgagaacaagacaaaggaatacaag
atcgtgggcctgtactcagacggcatcaatgtcctgggcttgattatcttctgcctcgtc
tttggccttgtcattgggaaaatgggagaaaaggggcagattctggtggacttcttcaat
gccttgagtgacgccaccatgaaaatcgtccagatcatcatgtgctacatgccgattggc
attttgttcctaattgctgggaagatcatagaagttgaagactgggaaatattccgcaag
ctgggcctttacatggccactgtcctgagcgggcttgcaatccactccctcatagttctg
cccctgctctatttcatagttgtgcggaagaaccctttccgctttgccttgggtatggcg
caggctctcctgacagctctcatgatctcgtccagttcggcaaccctgccagttacattc
cgctgtgcggaagaaaagaaccaggtagacaagaggatcacgagatttgtgctgcctgtt
ggtgccaccatcaacatggacggcactgcgctctacgaagctgtggcagccgtgtttatt
gcgcaactgaatggcttggacctaagcattgggcagatcgtcaccatcagcattacagcc
accgctgccagcattggagctgctggggtgccccaggctggcctggtgaccatggtgatc
gtgctgagtgctgtggggctgcctgccgaggacgtcaccctgatcattgctgttgactgg
ctcctggaccggttcaggaccatggtgaacgtcctgggtgatgcgtttgggacgggcatc
gtagagaagctctcgaagaaggagctggagcagatggatgtttcgtctgaagtcaacatc
gtgaacccctttgccttggaacccacaaccctcgataacgaagactcagataccaagaag
tcttatgtcaatgggggcttcgcggtagacaaatctgacaccatctcgttcactcagacc
tcacagttctag

KEGG   Mus musculus (house mouse): 20511
Entry
20511             CDS       T01002                                 
Symbol
Slc1a2, 1700091C19Rik, 2900019G14Rik, AI159670, Eaat2, GLT-1, GLT1, MGLT1
Name
(RefSeq) solute carrier family 1 (glial high affinity glutamate transporter), member 2
  KO
K05613  solute carrier family 1 (glial high affinity glutamate transporter), member 2
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04721  Synaptic vesicle cycle
mmu04724  Glutamatergic synapse
mmu05014  Amyotrophic lateral sclerosis
mmu05016  Huntington disease
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09156 Nervous system
   04724 Glutamatergic synapse
    20511 (Slc1a2)
   04721 Synaptic vesicle cycle
    20511 (Slc1a2)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    20511 (Slc1a2)
   05016 Huntington disease
    20511 (Slc1a2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    20511 (Slc1a2)
Transporters [BR:mmu02000]
 Solute carrier family (SLC)
  SLC1: High-affinity glutamate and neutral amino acid transporter
   20511 (Slc1a2)
SSDB
Motif
Pfam: SDF
Other DBs
NCBI-GeneID: 20511
NCBI-ProteinID: NP_001070982
MGI: 101931
Ensembl: ENSMUSG00000005089
Vega: OTTMUSG00000014848
UniProt: P43006 Q3UYK6
Position
2:102488584..102621129
AA seq 572 aa
MASTEGANNMPKQVEVRMHDSHLSSDEPKHRNLGMRMCDKLGKNLLLSLTVFGVILGAVC
GGLLRLASPIHPDVVMLIAFPGDILMRMLKMLILPLIISSLITGLSGLDAKASGRLGTRA
MVYYMSTTIIAAVLGVILVLAIHPGNPKLKKQLGPGKKNDEVSSLDAFLDLIRNLFPENL
VQACFQQIQTVTKKVLVAPPSEEANTTKAVISMLNETMNEAPEETKIVIKKGLEFKDGMN
VLGLIGFFIAFGIAMGKMGEQAKLMVEFFNILNEIVMKLVIMIMWYSPLGIACLICGKII
AIKDLEVVARQLGMYMITVIVGLIIHGGIFLPLIYFVVTRKNPFSFFAGIFQAWITALGT
ASSAGTLPVTFRCLEDNLGIDKRVTRFVLPVGATINMDGTALYEAVAAIFIAQMNGVILD
GGQIVTVSLTATLASIGAASIPSAGLVTMLLILTAVGLPTEDISLLVAVDWLLDRMRTSV
NVVGDSFGAGIVYHLSKSELDTIDSQHRMQEDIEMTKTQSIYDDKNHRESNSNQCVYAAH
NSVVIDECKVTLAANGKSADCSVEEEPWKREK
NT seq 1719 nt   +upstreamnt  +downstreamnt
atggcatcaacagagggtgccaacaatatgcccaagcaggtagaagtgcgcatgcatgac
agccacctcagctccgatgagccaaagcaccgaaacctgggcatgcgcatgtgcgacaag
ctggggaaaaatctcctgctctcactgactgtgtttggtgtcatcctgggagcagtgtgt
ggcgggctgcttcgcttggcatcgcccatccaccctgatgtggtcatgttgatagccttc
ccgggggacatactcatgaggatgctgaagatgctcatcctccctcttatcatctccagt
ttaatcacagggttgtcaggcctggatgctaaagccagcggccgcctaggcacgagagct
atggtgtattacatgtccacgaccatcattgccgccgtgctgggggtcatcctggtgttg
gccatccacccaggcaatcccaaactcaagaagcagctagggcccgggaagaagaacgac
gaggtgtctagcctggatgccttcctggatctcattagaaatctcttcccggagaacctg
gtgcaagcctgtttccagcagattcagacagtgacaaagaaagttctggtggcacctcca
tctgaggaggccaataccaccaaggcggtcatctccatgttgaatgaaaccatgaacgag
gcccctgaagaaactaagatcgttatcaagaagggcctggagttcaaggacgggatgaac
gtcttaggtctgatcggattctttattgctttcggcattgccatggggaagatgggtgaa
caggccaagctgatggtggagttcttcaacattctgaatgagatcgtgatgaagttagtg
atcatgatcatgtggtactcccctctgggtatcgcctgcttgatttgtgggaagatcatc
gccatcaaggacttagaagtggttgctaggcagctggggatgtacatgatcaccgtgatc
gtgggcctcatcattcacgggggcatctttctccccttgatttactttgtagtgaccaga
aaaaatccattctccttttttgctggcatattccaagcctggatcactgctctgggaact
gcttccagtgctggaactttgcctgttaccttccgttgcttggaagataatctagggatt
gacaagcgtgtgaccagattcgtcctcccagtcggagcaaccattaacatggatggcaca
gccctttacgaggctgtggcagccatcttcatagcccaaatgaatggggtcatcttggat
ggaggtcagattgtgactgtaagccttacagccaccctggcgagcattggtgcagccagt
attcccagcgccgggctggtcaccatgctcctcattctcacagctgtgggcctgccaacg
gaggatatcagtctgctggtggcggtggactggctgctggatagaatgagaacttcagtc
aatgtggtgggcgattcttttggggctgggattgtctatcacctttccaagtctgagctg
gacaccattgactcccaacaccgaatgcaggaagacatcgaaatgaccaagacgcagtcc
atttacgacgacaagaaccacagggaaagcaactctaatcagtgtgtctatgccgcacac
aactctgtcgtaatagatgagtgcaaggtaactctggcggccaatggaaagtcagctgac
tgcagtgttgaggaagaaccttggaaacgtgaaaaataa

KEGG   Mus musculus (house mouse): 20512
Entry
20512             CDS       T01002                                 
Symbol
Slc1a3, AI504299, B430115D02Rik, Eaat1, GLAST, GLAST-1, GLU-T, GluT-1, Gmt1, MGluT1
Name
(RefSeq) solute carrier family 1 (glial high affinity glutamate transporter), member 3
  KO
K05614  solute carrier family 1 (glial high affinity glutamate transporter), member 3
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04721  Synaptic vesicle cycle
mmu04724  Glutamatergic synapse
mmu05016  Huntington disease
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09156 Nervous system
   04724 Glutamatergic synapse
    20512 (Slc1a3)
   04721 Synaptic vesicle cycle
    20512 (Slc1a3)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05016 Huntington disease
    20512 (Slc1a3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    20512 (Slc1a3)
   04147 Exosome [BR:mmu04147]
    20512 (Slc1a3)
Transporters [BR:mmu02000]
 Solute carrier family (SLC)
  SLC1: High-affinity glutamate and neutral amino acid transporter
   20512 (Slc1a3)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of cortical neuronal cells
   20512 (Slc1a3)
SSDB
Motif
Pfam: SDF Yip1 MT
Other DBs
NCBI-GeneID: 20512
NCBI-ProteinID: NP_683740
MGI: 99917
Ensembl: ENSMUSG00000005360
Vega: OTTMUSG00000032639
UniProt: P56564 Q543U3
Position
15:complement(8663608..8742648)
AA seq 543 aa
MTKSNGEEPRMGGRMERLQQGVRKRTLLAKKKVQSLTKEDVKSYLFRNAFVLLTVTAVIV
GTILGFALRPYKMSYREVKYFSFPGELLMRMLQMLVLPLIISSLVTGMAALDSKASGKMG
MRAVVYYMTTTIIAVVIGIIIVIIIHPGKGTKENMYREGKIVQVTAADAFLDLIRNMFPP
NLVEACFKQFKTSYEKRSFKVPIQSNETLLGAVINNVSEAMETLTRIREEMVPVPGSVNG
VNALGLVVFSMCFGFVIGNMKEQGQALREFFDSLNEAIMRLVAVIMWYAPLGILFLIAGK
IVEMEDMGVIGGQLAMYTVTVIVGLLIHAVIVLPLLYFLVTRKNPWVFIGGLLQALITAL
GTSSSSATLPITFKCLEENNGVDKRITRFVLPVGATINMDGTALYEALAAIFIAQVNNFD
LNFGQIITISITATAASIGAAGIPQAGLVTMVIVLTSVGLPTDDITLIIAVDWFLDRLRT
TTNVLGDSLGAGIVEHLSRHELKNRDVEMGNSVIEENEMKKPYQLIAQDNEPEKPVADSE
TKM
NT seq 1632 nt   +upstreamnt  +downstreamnt
atgaccaaaagcaacggagaagagcctaggatggggggcaggatggagagattgcagcaa
ggggtccgcaagcggacacttctggccaagaagaaagttcagagcctcaccaaggaagat
gttaagagttacctgtttcggaatgccttcgttctgctcacggtcactgctgtcattgtg
ggtacaatccttggatttgccctccgaccgtataaaatgagctaccgggaggtgaagtac
ttttcgttccctggggagcttctcatgaggatgctgcagatgctggtcttgcccctgatc
atctccagtctcgtcacaggaatggcggccctagatagtaaggcatccgggaagatgggg
atgcgcgctgtagtctattacatgactactaccatcattgctgtggtgattggcataatc
attgtcatcatcatccaccccggaaagggcacaaaggaaaacatgtacagagaaggtaaa
atcgtgcaggtcactgcagcagatgccttcctggatttgatcaggaacatgttccctccc
aatctggtagaagcctgctttaaacagtttaaaaccagctacgagaaaagaagctttaaa
gtgcctatccagtccaacgaaacacttctgggcgccgtgatcaacaacgtgtcagaggcc
atggagactctgacccggatccgggaggagatggtgcccgtgcctggatctgtgaatggg
gtcaatgccctgggcctagttgtcttctccatgtgcttcggtttcgtgatcggaaacatg
aaggagcaggggcaagcgctgagagagttctttgattctcttaacgaagccatcatgcga
ttggtcgcggtgataatgtggtatgcgcctctgggcatcctcttcttgatcgcagggaag
attgttgagatggaagacatgggtgtgattgggggacagcttgccatgtacaccgtgaca
gtcattgtcggcctcctcattcacgccgtcatcgtcctgcctctcctctacttcctggta
acccggaagaacccctgggttttcattggagggttgctgcaagcgctcatcacagccctt
gggacctcctcaagttctgccaccctacccatcactttcaagtgcctggaagagaacaat
ggtgtggacaaacgcatcaccagatttgtgctccccgtgggggccaccattaacatggat
gggaccgccctctacgaggctttggctgccattttcatcgctcaagtgaacaactttgac
ctgaactttggacagattataacaataagcatcacagccacggccgcaagcatcggggca
gccgggattcctcaggccggtctggtcaccatggtcatcgtgctgacatctgtgggcctg
cccacagatgacatcacactcatcattgcagtggactggtttctggaccgcctccgaacc
accaccaacgtactgggtgactccctcggagcagggattgtcgagcacttgtcccgacat
gaactgaagaaccgagatgttgaaatggggaactcggtgattgaggagaacgaaatgaag
aagccgtatcagctgattgcccaggacaatgaaccggagaaacccgtggcagacagcgaa
accaagatgtag

KEGG   Mus musculus (house mouse): 20513
Entry
20513             CDS       T01002                                 
Symbol
Slc1a6, EAAT4
Name
(RefSeq) solute carrier family 1 (high affinity aspartate/glutamate transporter), member 6
  KO
K05617  solute carrier family 1 (high affinity glutamate/aspartate transporter), member 6
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04721  Synaptic vesicle cycle
mmu04724  Glutamatergic synapse
mmu05017  Spinocerebellar ataxia
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09156 Nervous system
   04724 Glutamatergic synapse
    20513 (Slc1a6)
   04721 Synaptic vesicle cycle
    20513 (Slc1a6)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05017 Spinocerebellar ataxia
    20513 (Slc1a6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    20513 (Slc1a6)
Transporters [BR:mmu02000]
 Solute carrier family (SLC)
  SLC1: High-affinity glutamate and neutral amino acid transporter
   20513 (Slc1a6)
SSDB
Motif
Pfam: SDF
Other DBs
NCBI-GeneID: 20513
NCBI-ProteinID: NP_033226
MGI: 1096331
Ensembl: ENSMUSG00000005357
UniProt: O35544 B2RQX4 Q3TXM3
Position
10:78615923..78650659
AA seq 561 aa
MSSHGNSLFLRESGAGGGCLQGLQDSLQQRALRTRLRLQTMTREHVRRFLRRNAFILLTV
SAVIIGVSLAFALRPYQLSYRQIKYFSFPGELLMRMLQMLVLPLIVSSLVTGMASLDNKA
TGRMGMRAAVYYMVTTVIAVFIGILMVTIIHPGKGSKEGLHREGRIETVPTADAFMDLVR
NMFPPNLVEACFKQFKTQYSTRVVTRTIVRTDNGSELGASMSPTSSVENETSILENVTRA
LGTLQEVISFEETVPVPGSANGINALGLVVFSVAFGLVIGGMKHKGRVLRDFFDSLNEAI
MRLVGIIIWYAPVGILFLIAGKILEMEDMAVLGGQLGMYTLTVIVGLFLHAGGVLPLIYF
LVTHRNPFPFIGGMLQALITAMGTSSSSATLPITFRCLEEGLGVDRRITRFVLPVGATVN
MDGTALYEALAAIFIAQVNNYELNLGQITTISITATAASVGAAGIPQAGLVTMVIVLTSV
GLPTEDITLIIAVDWFLDRLRTMTNVLGDSIGAAVIEHLSQRELELQEAELTLPSLGKPY
KSLMAQEKGASRGRGGNESVM
NT seq 1686 nt   +upstreamnt  +downstreamnt
atgagcagccacggcaatagtctgttcctgagggagagcggtgccggtgggggctgtctg
cagggcctgcaggacagcctgcagcagagagcactgcgcacgcgcttgcgcctgcagacc
atgacccgagagcacgtgaggcgcttcctgcgccggaatgccttcatcttgctcacagtc
agcgctgtgatcattggtgtcagcttggcatttgccttgcgcccgtaccagctctcctac
cgccagatcaagtacttctcctttcctggtgagctgctcatgaggatgctgcagatgctg
gtgttacccctcattgtctccagccttgtcacaggtatggcatccctggacaacaaggcg
acagggcggatgggaatgcgggcagctgtgtactacatggtgactacagtcattgcagtt
ttcatcggcatcctaatggttaccatcatacatcctgggaagggctccaaggaggggctg
caccgtgagggccgaattgagactgtcccaacagctgatgctttcatggacctggtcaga
aatatgtttccacctaaccttgtggaggcctgcttcaaacagtttaagacacagtacagc
acacgagtggtgacaaggacaattgtaaggacagacaatggttcagagctgggggcctcc
atgtctcccacatcctcagtagaaaatgaaaccagcatcctggaaaatgtcacccgggcc
ttgggcaccctgcaggaggtgataagctttgaggagactgtgcctgtacctggctcagcc
aatggcatcaatgccttgggccttgtggtcttctctgtggcctttgggctggtcattggt
ggcatgaagcacaaaggccgtgtcctgagggacttctttgacagcctcaatgaggctatt
atgaggctggtgggcatcatcatctggtatgcaccagtgggcatcctgttcctgattgct
ggaaagattctggaaatggaagacatggctgtccttggaggtcagctgggcatgtacaca
ctgactgtcatcgttggcttattccttcatgctggtggtgtgttgccccttatctacttc
ctcgtcacccatcggaacccctttcccttcattggtggtatgctacaggcactcatcaca
gctatgggtacctcttccagctctgcaactctgcctatcactttccgctgcctggaggag
ggcctgggtgtggatcgtcgcatcaccaggttcgtgctgcctgtgggggccactgtcaac
atggatggcactgcactctacgaggccttggcagccatctttattgctcaagtcaacaac
tatgagctcaaccttggtcagatcaccacaatcagcatcacagccacagctgccagcgta
ggagcagctggcatcccccaggcaggactggttaccatggtgattgtgctcacatccgtc
ggcctgcccacagaggacatcacactgatcatagctgtggattggttccttgaccgactt
cgtacaatgaccaatgtactgggggattcgattggagcggctgtcattgagcatttgtcc
caacgggagctggagctgcaggaggctgagctgactctacccagcctggggaaaccctat
aagtcactcatggcacaagaaaagggggcatcaaggggtcggggaggtaatgagagcgtc
atgtga

KEGG   Mus musculus (house mouse): 20538
Entry
20538             CDS       T01002                                 
Symbol
Slc6a2, NE-T, NET, Slc6a5
Name
(RefSeq) solute carrier family 6 (neurotransmitter transporter, noradrenalin), member 2
  KO
K05035  solute carrier family 6 (neurotransmitter transporter, noradrenalin) member 2
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04721  Synaptic vesicle cycle
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09156 Nervous system
   04721 Synaptic vesicle cycle
    20538 (Slc6a2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    20538 (Slc6a2)
Transporters [BR:mmu02000]
 Solute carrier family (SLC)
  SLC6: Sodium- and chloride-dependent neurotransmitter transporter
   20538 (Slc6a2)
SSDB
Motif
Pfam: SNF
Other DBs
NCBI-GeneID: 20538
NCBI-ProteinID: NP_033235
MGI: 1270850
Ensembl: ENSMUSG00000055368
Vega: OTTMUSG00000061538
UniProt: O55192 Q8R2I2
Position
8:93687100..93728295
AA seq 617 aa
MLLARMNPQVQPELGGADPLPEQPLRPCKTADLLVVKERNGVQCLLASQDSDAQPRETWG
KKIDFLLSVVGFAVDLANVWRFPYLCYKNGGGAFLIPYTLFLIIAGMPLFYMELALGQYN
REGAATVWKICPFFKGVGYAVILIALYVGFYYNVIIAWSLYYLFASFTLNLPWTNCGHSW
NSPNCTDPKLLNASVLGDHTKYSKYKFTPAAEFYERGVLHLHESSGIHDIGLPQWQLLLC
LMVVIVVLYFSLWKGVKTSGKVVWITATLPYFVLFVLLVHGVTLPGASNGINAYLHIDFY
RLKEATVWIDAATQIFFSLGAGFGVLIAFASYNKFDNNCYRDALLTSTINCVTSFISGFA
IFSILGYMAHEHKVNIEDVATEGAGLVFILYPEAISTLSGSTFWAVLFFLMLLALGLDSS
MGGMEAVITGLADDFQVLKRHRKLFTCVVTISTFLLALFCITKGGIYVLTLLDTFAAGTS
ILFAVLMEAIGVSWFYGVDRFSNDIQQMMGFKPGLYWRLCWKFVSPAFLLFVVVVSIINF
KPLTYDDYTYPPWANWVGWGIALSSMILVPAYVIYKFLSIRGSLWERVAYGITPENEHHL
VAQRDVRQFQLRHWLAI
NT seq 1854 nt   +upstreamnt  +downstreamnt
atgcttctggcgcgaatgaatccgcaggtgcagccggagctcggcggggcggacccgctg
cctgagcagcccctgaggccctgcaaaaccgccgatctactagtggtgaaggaacgcaac
ggagtccagtgcctcttggcgtcccaggacagcgacgctcagccccgggagacttggggc
aagaagattgatttcctgctgtccgtggtgggcttcgctgtggacctggccaacgtgtgg
cggttcccttatctctgctacaagaatggtggtggtgccttcctgattccatacacgctg
ttcctcatcattgctgggatgcctctgttttacatggagctggctctggggcaatacaac
cgggagggggcagccacagtgtggaagatctgccctttcttcaaaggagtgggctatgct
gtgatcctcattgccctctatgtcggcttttactacaatgtcatcatcgcctggtcactc
tactacctctttgcatccttcaccttgaacctgccctggaccaactgcggacactcctgg
aacagccccaactgtacggaccccaaactcctcaacgcctcggtgctgggtgaccatacc
aaatactccaaatacaagttcacaccagctgcggagttttatgaacgcggagtcctgcac
ttgcacgagagcagtgggatccatgacatcggcctgcctcaatggcagctgctgctctgt
ctgatggtcgtcatcgttgtcttgtatttcagcctctggaaaggagtgaagacatcagga
aaggttgtctggatcacagccaccctgccttactttgtcttgtttgtgctcctggtccat
ggcgtcacactgcccggtgcctccaatggcatcaatgcctacttgcacattgacttctac
cgcctcaaggaggccacggtatggattgatgctgcaacccagatatttttttctctgggg
gctggatttggagtcttgattgcatttgccagttacaataaatttgacaacaactgttac
agggatgctctactgaccagcaccatcaactgtgttaccagttttatttctggatttgcc
atcttctccatccttggttatatggcccatgaacataaggtcaatattgaggatgttgcc
actgaaggagctgggcttgtgtttatcctgtatccagaagccatctctactctgtcagga
tccacgttctgggccgtcctgttcttcttgatgctcctggctctggggctagatagttca
atgggaggcatggaagcagtcatcactggactggctgatgacttccaggtcctgaagcga
caccggaaactcttcacgtgtgttgtcaccatcagcaccttccttctggcattgttttgc
ataacaaagggagggatttatgtcctcactctgctggacacctttgcagcaggcacctcc
attctgtttgcggtgcttatggaagctattggagtttcctggttttatggtgtggacagg
ttcagcaatgacatccagcagatgatggggtttaagccaggcctgtactggaggctgtgt
tggaagttcgtgagccccgccttcctcctgtttgtggtggtggtcagcatcatcaacttc
aagccgcttacctatgatgactacacctatcctccctgggccaactgggtcgggtggggc
atcgccctctcatccatgatcctggtccctgcctatgtcatctacaagttcctcagcata
cgcggctccctgtgggagagagtggcctacggaatcaccccggagaatgagcaccacctg
gtggcccagagagacgtgagacagttccagttgcggcactggctggctatctga

KEGG   Mus musculus (house mouse): 232333
Entry
232333            CDS       T01002                                 
Symbol
Slc6a1, A730043E01, GABATHG, GABATR, GAT-1, Gabt, Gabt1, Gat1, XT-1, Xtrp1
Name
(RefSeq) solute carrier family 6 (neurotransmitter transporter, GABA), member 1
  KO
K05034  solute carrier family 6 (neurotransmitter transporter, GABA) member 1
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04721  Synaptic vesicle cycle
mmu04727  GABAergic synapse
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09156 Nervous system
   04727 GABAergic synapse
    232333 (Slc6a1)
   04721 Synaptic vesicle cycle
    232333 (Slc6a1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    232333 (Slc6a1)
Transporters [BR:mmu02000]
 Solute carrier family (SLC)
  SLC6: Sodium- and chloride-dependent neurotransmitter transporter
   232333 (Slc6a1)
SSDB
Motif
Pfam: SNF
Other DBs
NCBI-GeneID: 232333
NCBI-ProteinID: NP_848818
MGI: 95627
Ensembl: ENSMUSG00000030310
Vega: OTTMUSG00000056591
UniProt: P31648 Q6PCX2
Position
6:114259596..114294491
AA seq 599 aa
MATDNSKVADGQISTEVSEAPVASDKPKTLVVKVQKKAGDLPDRDTWKGRFDFLMSCVGY
AIGLGNVWRFPYLCGKNGGGAFLIPYFLTLIFAGVPLFLLECSLGQYTSIGGLGVWKLAP
MFKGVGLAAAVLSFWLNIYYIVIISWAIYYLYNSFTTTLPWKQCDNPWNTDRCFSNYSLV
NTTNMTSAVVEFWERNMHQMTDGLDKPGQIRWPLAITLAIAWVLVYFCIWKGVGWTGKVV
YFSATYPYIMLIILFFRGVTLPGAKEGILFYITPNFRKLSDSEVWLDAATQIFFSYGLGL
GSLIALGSYNSFHNNVYRDSIIVCCINSCTSMFAGFVIFSIVGFMAHVTKRSIADVAASG
PGLAFLAYPEAVTQLPISPLWAILFFSMLLMLGIDSQFCTVEGFITALVDEYPRLLRNRR
ELFIAAVCIVSYLIGLSNITQGGIYVFKLFDYYSASGMSLLFLVFFECVSISWFYGVNRF
YDNIQEMVGSRPCIWWKLCWSFFTPIIVAGVFLFSAVQMTPLTMGSYVFPKWGQGVGWLM
ALSSMVLIPGYMAYMFLTLKGSLKQRLQVMIQPSEDIVRPENGPEQPQAGSSASKEAYI
NT seq 1800 nt   +upstreamnt  +downstreamnt
atggcgactgacaacagcaaggtggctgatgggcagatctctactgaggtcagcgaggcc
cctgtggccagcgacaagcccaaaaccctggtagtcaaggtgcagaagaaggccggggac
ctccctgaccgggacacatggaagggacgcttcgacttcctcatgtcctgcgtgggctat
gccatcggcctgggcaatgtgtggaggttcccttacctctgtgggaaaaacggtggcggg
gccttcctaatcccatatttcctgacgctcatctttgcgggtgttcctctcttccttttg
gagtgctccctaggccagtacacctccattgggggcctgggcgtatggaagctggcgccc
atgttcaagggtgtgggcctcgcggcagctgtgctgtccttctggctgaacatctactac
atcgtcatcatctcctgggccatctactacctgtacaactccttcaccacgaccctgcca
tggaaacagtgtgacaacccgtggaacactgaccgctgcttctccaactacagcctggtc
aataccaccaacatgaccagcgccgtggtggagttctgggagcgcaacatgcaccagatg
acagatggactggacaagccaggacagatccgctggcctctggccatcacactggccatt
gcctgggtgctcgtgtatttctgcatctggaagggtgttggttggactggaaaggtggtc
tacttctcagccacgtacccctacatcatgcttatcatcctgttcttccgtggagtgacg
cttcccggggccaaggaggggatcctcttctacatcacacccaacttccgaaagctgtct
gattctgaggtgtggcttgacgccgccacccagatcttcttctcctacgggctgggcctg
gggtccctgattgctctgggaagctacaactctttccacaacaatgtgtacagggactcc
atcatcgtttgctgcatcaactcctgcaccagcatgtttgccggattcgtcatcttctcc
atcgtgggcttcatggctcatgtcaccaagaggtccatagctgatgtggcagcctcaggc
ccggggctggcattcttggcgtaccctgaggctgtgacacagctacccatctctcccctc
tgggctatcctcttcttctccatgctgctgatgctgggcattgacagccagttctgtacc
gtggagggcttcatcactgccctggtggacgagtaccccagacttctccgcaatcgccgt
gaactcttcattgctgccgtgtgcatcgtgtcctacctgattggcctgtctaacatcacc
cagggtggcatttatgtcttcaaactgtttgattattactctgccagcggcatgagcttg
ctgttcctggttttcttcgagtgtgtctccatttcctggttttatggtgtcaaccggttc
tatgacaacatccaggagatggttggctccaggccctgcatctggtggaagctgtgctgg
tcctttttcacacccatcattgtggcgggcgtgtttctcttcagtgctgtgcagatgaca
ccactcaccatgggaagctatgttttccccaagtggggccagggcgtgggctggctcatg
gctctgtcctccatggtgctcatccccgggtacatggcttacatgttcctcaccctgaag
ggctccctgaagcagcgtctccaggtcatgattcagcccagtgaagatattgtgcgccct
gagaatggccctgagcagccgcaggctggcagctcagccagcaaggaggcctacatctag

KEGG   Mus musculus (house mouse): 240332
Entry
240332            CDS       T01002                                 
Symbol
Slc6a7, AW455934, PROT
Name
(RefSeq) solute carrier family 6 (neurotransmitter transporter, L-proline), member 7
  KO
K05040  solute carrier family 6 (neurotransmitter transporter, L-proline) member 7
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04721  Synaptic vesicle cycle
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09156 Nervous system
   04721 Synaptic vesicle cycle
    240332 (Slc6a7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    240332 (Slc6a7)
Transporters [BR:mmu02000]
 Solute carrier family (SLC)
  SLC6: Sodium- and chloride-dependent neurotransmitter transporter
   240332 (Slc6a7)
SSDB
Motif
Pfam: SNF
Other DBs
NCBI-GeneID: 240332
NCBI-ProteinID: NP_958741
MGI: 2147363
Ensembl: ENSMUSG00000052026
UniProt: Q6PGE7
Position
18:complement(61128448..61147484)
AA seq 637 aa
MKKLQEAHLRKPITPDLLMTPSDQGDVDLDVDFAADRGNWTGKLDFLLSCIGYCVGLGNV
WRFPYRAYTNGGGAFLVPYFLMLAICGIPLFFLELSLGQFSSLGPLAVWKISPLFKGAGA
AMLLIVGLVAIYYNMIIAYVLFYLFASLTSNLPWEHCGNWWNTELCLEHRGPKSGNGVLP
LNLSSTVSPSEEYWSRYVLHIQGSQGIGRPGEIRWNLCLCLLLAWVIVFLCILKGVKSSG
KVVYFTATFPYLILLMLLVRGVTLPGAWKGIQFYLTPQFHHLLSSKVWIEAALQIFYSLG
VGFGGLLTFASYNTFHQNIYRDTFIVTLGNAITSILAGFAIFSVLGYMSQELGVPVDQVA
KAGPGLAFVVYPQAMTMLPLSPFWSFLFFFMLLTLGLDSQFAFLETIVTAVTDEFPYYLR
PKKAVFSGLICVAMYLMGLILTTDGGMYWLVLLDDYSASFGLMVVVITTCLAVTRVYGIQ
RFCRDIHMMLGFKPGLYFRACWLFLSPATLLALLVYSIVKYQPSEYGSYRFPAWAELLGI
LMGLLSCLMIPAGMLVAVLREEGSLWERLQQASRPAMDWGPSLEENRTGMYVATLAGSQS
PKPLMVHMRKYGGITSFENTAIEVDREIAEEEEESMM
NT seq 1914 nt   +upstreamnt  +downstreamnt
atgaagaagctccaagaagctcacctccgcaagcccatcaccccagacctgctgatgact
cccagtgaccagggcgatgtggacctggatgtagacttcgcagcagacaggggcaactgg
acgggcaagctggacttcctgctgtcctgcatcggctactgcgtgggcttgggaaatgtc
tggcgctttccctaccgagcctacaccaatggaggcggagccttcctcgtgccctacttc
ctcatgctggccatctgtggaatccccctcttctttcttgagctctccctgggccagttc
tccagcctgggacccctggctgtctggaaaatcagccctctctttaaaggtgcaggtgcg
gccatgctgctcattgtaggcctggtggccatttactacaacatgattatcgcctacgtc
ctcttctacctcttcgcctccctcaccagcaatttgccctgggagcactgtggcaactgg
tggaacacggagctttgcctggagcacagaggccccaagagtggtaatggggtgctgcct
cttaacctcagcagcaccgtcagccccagtgaggagtactggagccgctatgtcctgcac
atacagggcagccagggcatcggccgaccgggggagattcgctggaacctctgcctctgc
ctgctgctggcctgggtcatcgtgttcctctgtatcttgaagggggtgaagtcctcgggc
aaggtggtgtatttcacggccacctttccctacctcatcctcctcatgctgctggttcga
ggagtgacccttcccggggcctggaagggcatccagttctatctcaccccccagttccac
cacctgttatcttcaaaggtgtggattgaagctgctcttcagatcttttattctctagga
gtgggctttgggggtctcctcacctttgcttcctacaacacattccatcagaacatctac
agagacaccttcattgtcactctgggcaatgccatcactagcatcctggctggctttgct
atcttctcggtgctgggctacatgtctcaggagctgggtgtgcccgtggaccaagtggcc
aaagcaggccctggcctggcctttgttgtctacccacaggccatgaccatgttgcctctg
tcacctttctggtccttcctcttcttcttcatgcttctgacgcttggcctggatagccag
tttgcctttctagaaaccatagtgactgcagtgactgatgagttcccatactacctgcgg
cccaagaaggcagtgttctcaggactcatctgtgtggccatgtacctgatgggactgatt
ctcaccactgatgggggtatgtactggctggtccttttggatgactacagcgccagcttc
ggactcatggtggtggtgatcaccacgtgcctcgctgtcacccgggtatatggcatccag
cggttctgccgagatatccacatgatgctaggcttcaagccaggcctctacttcagggcc
tgctggctgtttctgtctccagctacactcttggccttgctggtgtacagcatcgtcaag
taccagccctcagaatatggcagctatcgcttccccgcctgggccgagctgctaggcatc
ctgatgggtctgctctcttgcctcatgatcccagctggtatgctggtagctgtgcttcga
gaggagggctcgctctgggagagacttcagcaagccagtcggcctgctatggactggggc
ccatctctggaagagaaccggacgggaatgtatgtggccacactggctgggagccagtca
ccaaagccactgatggtacacatgcgcaaatacgggggcatcaccagcttcgagaacacg
gccattgaggtggaccgtgagatcgcagaggaggaggaggagtctatgatgtga

KEGG   Mus musculus (house mouse): 242607
Entry
242607            CDS       T01002                                 
Symbol
Slc1a7, A930031E15Rik, Eaat5
Name
(RefSeq) solute carrier family 1 (glutamate transporter), member 7
  KO
K05618  solute carrier family 1 (glutamate transporter), member 7
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04721  Synaptic vesicle cycle
mmu04724  Glutamatergic synapse
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09156 Nervous system
   04724 Glutamatergic synapse
    242607 (Slc1a7)
   04721 Synaptic vesicle cycle
    242607 (Slc1a7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    242607 (Slc1a7)
Transporters [BR:mmu02000]
 Solute carrier family (SLC)
  SLC1: High-affinity glutamate and neutral amino acid transporter
   242607 (Slc1a7)
SSDB
Motif
Pfam: SDF DUF2417
Other DBs
NCBI-GeneID: 242607
NCBI-ProteinID: NP_666367
MGI: 2444087
Ensembl: ENSMUSG00000008932
Vega: OTTMUSG00000009321
UniProt: Q8JZR4 Z4YKJ7
Position
4:107825603..107870726
AA seq 559 aa
MVLDAVLARGRTVCKHNGLLILSVLSVIVGCLLGFFLRTQRLSPQEISYFQFPGELLMRM
LKMLILPLVVSSLMSGLASLDAKTSSRLGILTVAYYLWTTFLAVVVGIIMVSIIHPGGAA
QKETTEQSGKPVMSSADALLDLVRNMFPANLVEATFKQYRTKTTPVIKSPRGAAEEAPRR
IVIYGVQEDNGSRVQNFALDLTPPPEIVYKSEPGTSDGMNVLGIVIFSATMGIMLGRMGD
SGTPLVSFCQCLNESVMKIVAVAGWYFPFGIVFLIAGKILEMDDPKAVGKKLGFYAVTVV
CGLVVHGLLILPLLYFLITKKNPIVFIRGVLQALLIALATSSSSATLPITFKCLLENNHI
DRRIARFVLPVGATINMDGTALYEAVAAIFIAQVNNYELDFGQIITISITATAASIGAAG
IPQAGLVTMVIVLTSVGLPTDDINLIIAVDWALDRFRTMINVLGDALAAGIMAHICRKDF
AQDMGTEKLLPCETKPVTLQEIVAAQQNGCVKSVAEASELTLGPTCPHHIPVQVEQDEDP
AAASLDHCTIEISELETNV
NT seq 1680 nt   +upstreamnt  +downstreamnt
atggtgctcgacgctgtcctggctcgagggcgcacagtgtgtaagcacaacgggctgctc
atcctgtctgtgctctctgtcatcgtgggctgcctccttggcttcttcctcaggacccag
cgcctctcaccacaggagattagttacttccagttccctggagaactcttgatgcggatg
ctgaagatgctgatcctaccactggtggtctccagcttgatgtccggccttgcctccctg
gatgccaagacctccagccgcttggggatcctcaccgtggcatactacctgtggactacc
tttctggctgttgttgtgggcatcatcatggtctccatcatccaccctggtggtgcagca
cagaaggagacaactgaacagagtggaaagccggtcatgagctcagctgatgccctcctg
gatcttgtccggaacatgttcccagccaacctggtagaagccacgttcaaacagtaccgc
accaagaccaccccagttatcaagtctcccaggggagcagcggaggaggctccccggcgg
atcgtcatctatggggtccaggaagacaatggctcacgtgtgcagaactttgccctggat
ctgacgcccccacctgagattgtctacaagtcagagcctggtaccagtgatggcatgaac
gtgctaggcattgtcatcttctcagccacgatgggtatcatgctgggccgcatgggtgac
agcgggacgcccctggtcagcttctgtcagtgccttaatgagtctgtcatgaagatcgtg
gcagtggcagggtggtactttccctttggcattgtcttcctgatcgctggcaagatcttg
gagatggatgaccccaaggcagtggggaaaaagctgggcttctacgccgtgactgtggtt
tgtgggctggtggtccacggtctcctcatcctgcccctactgtacttcctcatcaccaag
aagaaccccatcgtcttcatccgaggcgtcctccaggctctgctcattgcgttggccacc
tcctccagctcagccacactgcccatcaccttcaagtgcctgctggagaacaaccatatc
gaccgccgcatcgctcgcttcgtgctgcctgtgggcgccaccatcaacatggatggcacc
gcgctctacgaggccgtggctgccatctttatcgcccaggtcaacaactatgagctagac
tttggacagatcatcactatcagcatcacggccacggcagccagcattggggcggctggc
atcccccaggcggggctcgtcaccatggtcatcgtgctcacctctgtgggactgccgacc
gatgacatcaacctcatcatagctgtagactgggcactggatcgcttccgaaccatgatt
aatgtgctgggtgatgcactggcggcagggatcatggcccacatctgccggaaggatttt
gctcaggacatgggcactgagaaattgctaccctgtgagaccaagccagtgacactgcag
gagatcgtggctgcccagcagaatggctgtgtgaagagtgtggctgaggcctcagagcta
accctgggccccacgtgcccccaccacatcccagtccaggtagagcaggatgaggatcca
gccgctgccagcctagaccactgtactattgagatcagtgagctagagaccaacgtgtga

KEGG   Mus musculus (house mouse): 243616
Entry
243616            CDS       T01002                                 
Symbol
Slc6a11, D930045G19Rik, E130202I16Rik, GAT4, Gabt4, Gat3
Name
(RefSeq) solute carrier family 6 (neurotransmitter transporter, GABA), member 11
  KO
K05044  solute carrier family 6 (neurotransmitter transporter, GABA) member 11
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04721  Synaptic vesicle cycle
mmu04727  GABAergic synapse
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09156 Nervous system
   04727 GABAergic synapse
    243616 (Slc6a11)
   04721 Synaptic vesicle cycle
    243616 (Slc6a11)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    243616 (Slc6a11)
Transporters [BR:mmu02000]
 Solute carrier family (SLC)
  SLC6: Sodium- and chloride-dependent neurotransmitter transporter
   243616 (Slc6a11)
SSDB
Motif
Pfam: SNF
Other DBs
NCBI-GeneID: 243616
NCBI-ProteinID: NP_766478
MGI: 95630
Ensembl: ENSMUSG00000030307
Vega: OTTMUSG00000056547
UniProt: P31650
Position
6:114108202..114226847
AA seq 627 aa
MTAEQALPLGNGKAAEEARGSETLGGGGGGAAGTREARDKAVHERGHWNNKVEFVLSVAG
EIIGLGNVWRFPYLCYKNGGGAFLIPYVVFFICCGIPVFFLETALGQFTSEGGITCWRRV
CPLFEGIGYATQVIEAHLNVYYIIILAWAIFYLSNCFTTELPWATCGHEWNTEKCVEFQK
LNFSNYSHVSLQNATSPVMEFWERRVLAISDGIEHIGNLRWELALCLLAAWTICYFCIWK
GTKSTGKVVYVTATFPYIMLLILLIRGVTLPGASEGIKFYLYPDLSRLSDPQVWVDAGTQ
IFFSYAICLGCLTALGSYNNYNNNCYRDCIMLCCLNSGTSFVAGFAIFSVLGFMAYEQGV
PIAEVAESGPGLAFIAYPKAVTMMPLSPLWATLFFMMLIFLGLDSQFVCVESLVTAVVDM
YPKVFRRGYRRELLILALSIISYFLGLVMLTEGGMYIFQLFDSYAASGMCLLFVAIFECV
CIGWVYGSNRFYDNIEDMIGYRPLSLIKWCWKVVTPGICAGIFIFFLVKYKPLKYNNVYT
YPAWGYGIGWLMALSSMLCIPLWIFIKLWKTEGTLPEKLQKLTVPSADLKMRGKLGASPR
TVTVNDCEAKVKGDGTISAITEKETHF
NT seq 1884 nt   +upstreamnt  +downstreamnt
atgactgcggagcaagcgctgcccctgggcaacgggaaagcggccgaggaggcgcggggg
tccgagacgctgggcggcggcggcgggggcgcggcggggacgcgcgaggcgcgcgacaag
gctgtccacgagcgcggccactggaacaacaaggtggagttcgtgttgagcgtagctgga
gagatcatcggactgggcaacgtgtggcgctttccctacctgtgctacaaaaacggcgga
ggggcattcctgattccttacgtggtgtttttcatctgctgcggaatccccgtcttcttc
ctggaaacggctctggggcagttcacgagcgagggtggcatcacgtgctggaggagggtc
tgccctttatttgaaggcattggctatgcaacacaggtgatcgaggcacacctcaatgtc
tactacatcatcatcctggcgtgggccatcttctacctaagcaattgcttcaccaccgag
ctcccctgggccacctgtgggcacgagtggaacacagagaaatgtgtggagttccagaag
ctgaacttcagcaactacagtcatgtgtccctgcagaatgccacctccccggtcatggag
ttctgggaacgccgggtcttggctatatccgatggcattgagcacattgggaacctccgt
tgggaactggcattatgtctcctggcggcctggaccatctgctacttctgcatatggaag
ggtactaagtcgactggaaaggtcgtgtatgtcactgcaaccttcccctacatcatgctg
ctgatcctcctgatccgaggggtcacgttgccaggcgcctctgaaggcatcaagttctat
ctgtaccctgacctctcccggctctctgacccacaggtgtgggtggacgctgggacgcag
atctttttctcctatgccatctgcctgggctgcctaaccgctctggggagttacaacaac
tataacaacaactgctacagggactgcattatgctctgctgtctaaacagtggcaccagc
ttcgtggctgggtttgccatcttctcagtcctgggcttcatggcatacgagcagggtgtg
cctattgccgaggtggcagagtcaggtcctggactggctttcatcgcctaccccaaggct
gtcactatgatgcccctctctccactgtgggccaccttgttcttcatgatgctcatcttc
ctgggcctggacagtcagtttgtgtgcgtggagagtcttgtgacagccgtggtagacatg
taccctaaggtcttccggcggggctaccggcgagaactgctcatcctggccctgtccatc
atctcctatttcctaggcctggtgatgctgaccgagggaggcatgtacatcttccagctt
tttgactcatacgccgccagtggcatgtgcttgctctttgtggccatctttgagtgtgtc
tgcatcggctgggtatatggaagcaaccggttctatgacaatattgaggatatgattggt
taccggccactgtcactcatcaagtggtgctggaaagtcgtgacccctgggatctgtgcg
ggcatcttcatcttctttctggtcaagtacaaaccgctcaagtacaacaatgtgtacaca
tatcctgcttggggctacggcatcggctggctcatggctctgtcctccatgctgtgtatc
ccactctggatcttcattaagctgtggaagacagagggcacactgcccgagaaattacag
aagttgacagtccccagcgccgatctgaaaatgcggggcaagcttggggccagcccacgg
acggtgaccgttaatgactgtgaggccaaggtcaagggcgacggcaccatctctgccatc
acagagaaggagacacacttctga

DBGET integrated database retrieval system