KEGG   Mus musculus (mouse): 105243
Entry
105243            CDS       T01002                                 

Symbol
Slc9a3, 9030624O13Rik, AI930210, NHE, NHE-, NHE-3, NHE3
Name
(RefSeq) solute carrier family 9 (sodium/hydrogen exchanger), member 3
  KO
K12040  solute carrier family 9 (sodium/hydrogen exchanger), member 3
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04964  Proximal tubule bicarbonate reclamation
mmu04974  Protein digestion and absorption
mmu04976  Bile secretion
mmu04978  Mineral absorption
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09154 Digestive system
   04976 Bile secretion
    105243 (Slc9a3)
   04974 Protein digestion and absorption
    105243 (Slc9a3)
   04978 Mineral absorption
    105243 (Slc9a3)
  09155 Excretory system
   04964 Proximal tubule bicarbonate reclamation
    105243 (Slc9a3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    105243 (Slc9a3)
Transporters [BR:mmu02000]
 Solute carrier family (SLC)
  SLC9: Na+/H+ exchanger
   105243 (Slc9a3)
SSDB
Motif
Pfam: Na_H_Exchanger NEXCaM_BD
Other DBs
NCBI-GeneID: 105243
NCBI-ProteinID: NP_001074529
MGI: 105064
Ensembl: ENSMUSG00000036123
UniProt: G3X939
Position
13 C1; 13 40.15 cM
AA seq 829 aa
MWHRALGPGWKLLLALALTSLQGARGAEEEPSSDGSFQVVTFKWHHVQDPYIIALWILVA
SLAKIVFHLSHKVTSIVPESALLIVLGLVLGGIVWAADHIASFTLTPTLFFFYLLPPIVL
DAGYFMPNRLFFGNLGTILLYAVIGTIWNAATTGLSLYGVFLSGLMGELKIGLLDFLLFG
SLIAAVDPVAVLAVFEEVHVNEVLFIIVFGESLLNDAVTVVLYNVFESFVTLGGDAVTGV
DCVKGIVSFFVVSLGGTLVGVIFAFLLSLVTRFTKHVRIIEPGFVFVISYLSYLTSEMLS
LSSILAITFCGICCQKYVKANISEQSATTVRYTMKMLASGAETIIFMFLGISAVNPDIWT
WNTAFVLLTLVFISVYRAIGVVLQTWILNRYRMVQLETIDQVVMSYGGLRGAVAYALVVL
LDEKKVKEKNLFVSTTLIVVFFTVIFQGLTIKPLVQWLKVKRSEHREPKLNEKLHGRAFD
HILSAIEDISGQIGHNYLRDKWSNFDRKFLSKVLMRRSAQKSRDRILNVFHELNLKDAIS
YVAEGERRGSLAFIRSPSTDNMVNVDFNTPRPSTVEASVSYFLRENVSAVCLDMQSLEQR
RRSIRDTEDMVTHHTLQQYLYKPRQEYKHLYSRHELTPNEDEKQDKEIFHRTMRKRLESF
KSAKLGINQNKKAAKLYKRERAQKRRNSSIPNGKLPMENLAHNYTIKEKDLELSEHEEAT
NYEEISGGIEFLASVTQDVASDSGAGIDNPVFSPDEDLDPSILSRVPPWLSPGETVVPSQ
RARVQIPNSPSNFRRLTPFRLSNKSVDSFLQADGHEEQLQPAAPESTHM
NT seq 2490 nt   +upstreamnt  +downstreamnt
atgtggcaccgggctctgggaccagggtggaagctgctgctggccctggcgctgaccagc
ctgcaaggcgcgaggggggctgaggaggaaccgagcagtgatgggagcttccaggtggtc
accttcaaatggcaccacgtccaggatccatacatcattgcgctctggatcctcgtggcc
agcttggccaaaatcgtctttcacctgtcccacaaggtcaccagtatcgtccccgagagt
gctctactcatcgttctgggcctggtgttgggtggcatcgtctgggcagctgaccacatc
gcctccttcacactcacacccacgctcttcttcttctacctgctgccccctattgtgttg
gatgctggatacttcatgcccaatcgactcttctttggcaacctgggcaccattctgcta
tatgctgtcattggcactatatggaatgcagccaccacaggattgtccctctatggtgtc
ttcctcagtggcttgatgggtgaactgaaaattggactcctggatttcttgctgtttggt
agcctcattgcagctgtggacccagtggctgtgctggctgtgtttgaggaagtccatgtc
aatgaagtcctcttcatcattgtctttggggagtcactgctgaatgatgcagtgactgtg
gtcttgtacaatgtttttgagtcttttgtgacactgggtggtgacgcagtgactggcgtg
gattgtgtgaaaggcatagtgtccttcttcgtggtgagcctggggggcactctggtgggt
gttatcttcgccttcctgctgtccttggtgactcgcttcaccaagcatgtgcgtatcatc
gagcctggcttcgtctttgtcatttcctacctgtcctatctgacctccgagatgctgtct
ttgtcatccatcctggccatcaccttttgcggcatctgctgtcagaagtacgtgaaggcc
aacatctcagagcagtcggccaccactgtgcgctacactatgaagatgctggccagtgga
gcagagaccattatctttatgttcctgggtatctcagctgtgaaccccgacatctggaca
tggaacacagcttttgtgttgctgacactggtcttcatttctgtatatcgagccattggt
gttgttctgcagacctggatcctgaatcgctacagaatggtgcagctagaaaccattgac
caggtggtcatgtcctatggtggcctgcgtggggcagtggcctatgccttggtggtactt
ctggatgagaagaaagtcaaggagaaaaatctgtttgtcagcaccactctcattgtggtt
ttcttcacagtcatctttcagggcctgaccattaagcccctggtgcagtggctgaaggtg
aagaggagcgagcatcgtgagccaaagctcaatgagaagctacatggccgggctttcgac
cacatcctctcagccattgaggacatctcaggacaaattggacacaattacctcagagat
aagtggtccaattttgaccggaagttcctcagcaaagtcctcatgagaagatctgctcaa
aaatctcgagatcggatcctgaatgttttccatgagctgaatttgaaggatgctatcagc
tatgtggctgagggagagcgccgtgggtccctggccttcattcgctccccaagtacggac
aatatggtcaatgtggacttcaacacaccccgcccatctactgtggaggcgtctgtctca
tatttcttgagggaaaatgtcagtgctgtatgcctggacatgcagtccttggaacagagg
cggaggagcatccgtgacaccgaggacatggtcacccaccacacactgcaacagtacctg
tacaagcctcggcaggagtacaagcatctctatagtcggcacgagctaacacccaatgag
gatgaaaagcaggacaaggaaatctttcacagaaccatgaggaagcgcctggagtccttt
aagtcagctaagctaggcatcaaccagaataagaaggcggccaagctgtacaagagggag
cgcgcacagaagcggaggaatagcagcattcctaatgggaaactgcctatggagaacctg
gcacacaactacaccatcaaggagaaagatttggaactttcagagcatgaggaggccacc
aactatgaagagatcagtggaggcattgagtttctggccagtgtcacccaggatgtagcc
tctgactctggggcaggaattgataatcccgtgttctcccctgatgaggatctggaccca
agcatcctatccagggtgccaccctggctgtcccctggggagaccgtggtgccctcccag
agggcccgtgttcagattccaaactctcccagcaacttccgccgcctgacaccattccgc
ctcagcaacaaatccgtggattccttcctgcaggctgatggccacgaggaacagctccaa
ccggctgcccccgagtccacacacatgtaa

DBGET integrated database retrieval system