KEGG   Mus musculus (mouse): 106557
Entry
106557            CDS       T01002                                 

Gene name
Ldhal6b, 4933402O15Rik, AI326310, LD, LDHL, Ldhal
Definition
(RefSeq) lactate dehydrogenase A-like 6B
  KO
K00016  L-lactate dehydrogenase [EC:1.1.1.27]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00010  Glycolysis / Gluconeogenesis
mmu00270  Cysteine and methionine metabolism
mmu00620  Pyruvate metabolism
mmu00640  Propanoate metabolism
mmu01100  Metabolic pathways
mmu04066  HIF-1 signaling pathway
mmu04922  Glucagon signaling pathway
mmu05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    106557 (Ldhal6b)
   00620 Pyruvate metabolism
    106557 (Ldhal6b)
   00640 Propanoate metabolism
    106557 (Ldhal6b)
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    106557 (Ldhal6b)
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    106557 (Ldhal6b)
 09150 Organismal Systems
  09152 Endocrine system
   04922 Glucagon signaling pathway
    106557 (Ldhal6b)
 09160 Human Diseases
  09161 Cancer: overview
   05230 Central carbon metabolism in cancer
    106557 (Ldhal6b)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    106557 (Ldhal6b)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.27  L-lactate dehydrogenase
     106557 (Ldhal6b)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   106557 (Ldhal6b)
  Exosomal proteins of breast milk
   106557 (Ldhal6b)
SSDB
Motif
Pfam: Ldh_1_N Ldh_1_C UDPG_MGDP_dh_N F420_oxidored Glyco_hydro_4
Other DBs
NCBI-GeneID: 106557
NCBI-ProteinID: NP_780558
MGI: 2146830
Ensembl: ENSMUSG00000101959
Vega: OTTMUSG00000045083
UniProt: Q8BVP2
Position
17; 17 A1
AA seq 382 aa
MAWATSILRASRRVSTTRVDFKGFGIALWPSQVQRVPPNRAWWSLTPTSSMATVKGELIQ
HISSEEPVLHNKVSIVGTGSVGMACAIGIIAKGLTDELALVDNNEEKMKGETMDLQHGSV
FMKMPNIVCSKDFRVTANSEVVIITAGARQEKNETRLNLVQRNVTIFKAMVAEIIKHSPR
CKIIVVSNPVDILTFVTWKLSGFPKNRIIGSGCNLDTARFRYMLGQRLGIHSESCHGWVL
GEHGDSSVPVWSGVNIAGVPLRELNSAIGTSKDPEKWGDVHKEVIASAYNIIKMKGYTSW
AIGLSVTDIAESILKNLRKTHPVTTKIQGLYGIKEEVFLSVPCILGESGISDIIKVKLSP
TEEAQMVKSAETIWKIQKDIKF
NT seq 1149 nt   +upstreamnt  +downstreamnt
atggcctgggctacaagcatcttgagagccagcagaagagtgagtacaaccagggtagat
ttcaagggctttggcatagctctatggcccagtcaggtgcaacgtgtccctcccaaccgg
gcctggtggagcctcacgcccacgtcctccatggcgaccgtgaagggtgaacttatccag
cacatcagctccgaagagcccgttctccacaacaaggtctccattgtaggaactggatca
gtcggcatggcctgtgccatcggcatcatagcgaaaggcttgactgacgagctcgccctt
gttgataataatgaagaaaaaatgaagggtgagacgatggatcttcagcacggcagtgtc
ttcatgaaaatgccaaatattgtttgcagcaaggatttccgtgtcactgccaactctgag
gtagtgattatcacagcgggtgcacgccaagagaaaaatgagacacgcctgaatttagtc
cagcgaaacgtaaccatctttaaggcaatggttgcggaaattatcaagcacagccctcgc
tgcaaaattattgttgtctccaatccagtggatatcttaactttcgtaacctggaagttg
agtgggtttcccaaaaaccgtattattggaagcggctgtaacctagatacagctcgcttc
cgttacatgctcgggcagaggcttgggatccactctgaaagctgccacgggtgggtcctt
ggagagcatggagattcaagtgtccctgtgtggagtggtgtgaacatcgccggcgtgccg
ctgagagagctgaattcagctataggaacaagcaaagaccccgagaaatggggcgatgtc
cacaaagaagtcattgccagtgcctataatattatcaaaatgaaaggttatacttcctgg
gccattggcctgtctgtaactgatattgcagagagtatcctgaagaatctcaggaagacg
catccagttaccaccaaaatccaaggtctctacggaatcaaagaggaggtgttcctcagc
gtgccttgtatcctgggagagagtggcatatctgatatcataaaggtaaagctgagccct
acagaggaggcccagatggtaaagagcgcagagactatttggaaaatccagaaagatatt
aagttttaa

KEGG   Mus musculus (mouse): 16828
Entry
16828             CDS       T01002                                 

Gene name
Ldha, LDH, Ldh-, Ldh1, Ldhm, l7, l7R2
Definition
(RefSeq) lactate dehydrogenase A
  KO
K00016  L-lactate dehydrogenase [EC:1.1.1.27]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00010  Glycolysis / Gluconeogenesis
mmu00270  Cysteine and methionine metabolism
mmu00620  Pyruvate metabolism
mmu00640  Propanoate metabolism
mmu01100  Metabolic pathways
mmu04066  HIF-1 signaling pathway
mmu04922  Glucagon signaling pathway
mmu05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    16828 (Ldha)
   00620 Pyruvate metabolism
    16828 (Ldha)
   00640 Propanoate metabolism
    16828 (Ldha)
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    16828 (Ldha)
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    16828 (Ldha)
 09150 Organismal Systems
  09152 Endocrine system
   04922 Glucagon signaling pathway
    16828 (Ldha)
 09160 Human Diseases
  09161 Cancer: overview
   05230 Central carbon metabolism in cancer
    16828 (Ldha)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    16828 (Ldha)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.27  L-lactate dehydrogenase
     16828 (Ldha)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   16828 (Ldha)
  Exosomal proteins of breast milk
   16828 (Ldha)
SSDB
Motif
Pfam: Ldh_1_N Ldh_1_C Pyr_redox_2 Glyco_hydro_4 Glyco_hydro_4C
Other DBs
NCBI-GeneID: 16828
NCBI-ProteinID: NP_034829
MGI: 96759
Ensembl: ENSMUSG00000063229
Vega: OTTMUSG00000016500
UniProt: P06151 Q564E2
Position
7 B3; 7 30.6 cM
AA seq 332 aa
MATLKDQLIVNLLKEEQAPQNKITVVGVGAVGMACAISILMKDLADELALVDVMEDKLKG
EMMDLQHGSLFLKTPKIVSSKDYCVTANSKLVIITAGARQQEGESRLNLVQRNVNIFKFI
IPNIVKYSPHCKLLIVSNPVDILTYVAWKISGFPKNRVIGSGCNLDSARFRYLMGERLGV
HALSCHGWVLGEHGDSSVPVWSGVNVAGVSLKSLNPELGTDADKEQWKEVHKQVVDSAYE
VIKLKGYTSWAIGLSVADLAESIMKNLRRVHPISTMIKGLYGINEDVFLSVPCILGQNGI
SDVVKVTLTPEEEARLKKSADTLWGIQKELQF
NT seq 999 nt   +upstreamnt  +downstreamnt
atggcaaccctcaaggaccagctgattgtgaatcttcttaaggaagagcaggctccccag
aacaagattacagttgttggggttggtgctgttggcatggcttgtgccatcagtatctta
atgaaggacttggcggatgagcttgcccttgttgacgtcatggaagacaaactcaagggc
gagatgatggatctccagcatggcagcctcttccttaaaacaccaaaaattgtctccagc
aaagactactgtgtaactgcgaactccaagctggtcattatcaccgcgggggcccgtcag
caagagggggagagccggctcaacctggtccagcgaaacgtgaacatcttcaagttcatc
attcccaacattgtcaagtacagtccacactgcaagctgctgatcgtctccaatccagtg
gatatcttgacctacgtggcttggaaaatcagtggctttcccaaaaaccgagtaattgga
agtggttgcaatctggattcagcgcggttccgttacctgatgggagagaggctgggggtt
cacgcgctgagctgtcacggctgggtcctgggagaacatggcgactccagtgtgcctgtg
tggagtggtgtgaatgttgccggcgtctccctgaagtctcttaacccagaactgggcact
gacgcagacaaggagcagtggaaggaggttcacaagcaggtggtggacagtgcctacgag
gtgatcaagctgaaaggttacacatcctgggccattggcctctctgtggcagacttggct
gagagcataatgaagaaccttaggcgggtgcatcccatttccaccatgattaagggtctc
tatggaatcaatgaggatgtcttcctcagtgtcccatgtatcctgggacaaaatggaatc
tcggatgttgtgaaggtgacactgactcctgaggaagaggcccgcctgaagaagagcgca
gacaccctctggggaatccagaaggagctgcagttctaa

KEGG   Mus musculus (mouse): 16832
Entry
16832             CDS       T01002                                 

Gene name
Ldhb, AI790582, H-Ld, H-Ldh, LDH-B, LDH-H, Ldh-, Ldh-2, Ldh2
Definition
(RefSeq) lactate dehydrogenase B
  KO
K00016  L-lactate dehydrogenase [EC:1.1.1.27]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00010  Glycolysis / Gluconeogenesis
mmu00270  Cysteine and methionine metabolism
mmu00620  Pyruvate metabolism
mmu00640  Propanoate metabolism
mmu01100  Metabolic pathways
mmu04066  HIF-1 signaling pathway
mmu04922  Glucagon signaling pathway
mmu05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    16832 (Ldhb)
   00620 Pyruvate metabolism
    16832 (Ldhb)
   00640 Propanoate metabolism
    16832 (Ldhb)
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    16832 (Ldhb)
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    16832 (Ldhb)
 09150 Organismal Systems
  09152 Endocrine system
   04922 Glucagon signaling pathway
    16832 (Ldhb)
 09160 Human Diseases
  09161 Cancer: overview
   05230 Central carbon metabolism in cancer
    16832 (Ldhb)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    16832 (Ldhb)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.27  L-lactate dehydrogenase
     16832 (Ldhb)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   16832 (Ldhb)
  Exosomal proteins of breast milk
   16832 (Ldhb)
SSDB
Motif
Pfam: Ldh_1_N Ldh_1_C Glyco_hydro_4
Other DBs
NCBI-GeneID: 16832
NCBI-ProteinID: NP_032518
MGI: 96763
Ensembl: ENSMUSG00000030246
Vega: OTTMUSG00000016379
UniProt: P16125
Position
6 G2; 6 74.17 cM
AA seq 334 aa
MATLKEKLIASVADDEAAVPNNKITVVGVGQVGMACAISILGKSLADELALVDVLEDKLK
GEMMDLQHGSLFLQTPKIVADKDYSVTANSKIVVVTAGVRQQEGESRLNLVQRNVNVFKF
IIPQIVKYSPDCTIIVVSNPVDILTYVTWKLSGLPKHRVIGSGCNLDSARFRYLMAEKLG
IHPSSCHGWILGEHGDSSVAVWSGVNVAGVSLQELNPEMGTDNDSENWKEVHKMVVDSAY
EVIKLKGYTNWAIGLSVADLIESMLKNLSRIHPVSTMVKGMYGIENEVFLSLPCILNARG
LTSVINQKLKDDEVAQLRKSADTLWDIQKDLKDL
NT seq 1005 nt   +upstreamnt  +downstreamnt
atggcaacccttaaggagaagctcattgcgtccgttgcagatgatgaggctgccgtcccg
aacaacaagatcactgtagtgggcgttggacaagtgggtatggcatgtgccatcagcatt
ctgggaaagtctctggctgatgaacttgccctggtggatgtgttggaagacaagctcaaa
ggagagatgatggacctgcagcacgggagcttgttcctccagactccgaaaattgtggcc
gataaagattactctgtgacagccaactctaagattgtggtggtgacggcaggagtccgc
cagcaggagggggagagtcggctcaacctggtgcagagaaatgtcaacgtgttcaagttc
atcattcctcagatcgtcaagtacagccctgactgcaccatcatcgtggtttccaaccca
gtggatattctgacttacgtcacctggaaactgagcgggctacctaagcaccgtgtgatt
ggaagcggatgcaatctggattctgctcgattccgctacctcatggcagagaagcttggc
attcatcccagcagctgccacggatggatcctgggcgagcatggagactccagtgtggct
gtgtggagcggggtgaatgtggcaggagtctccctccaggaactgaatccagaaatgggg
acagacaatgacagtgagaactggaaggaggtgcataagatggtggtggacagtgcctat
gaagtcatcaagctcaaaggctacaccaactgggccatcggcctgagcgtggctgacctc
atcgagtccatgctgaaaaacctctcccggattcaccccgtgtctaccatggtgaaggga
atgtacggcattgagaatgaagtcttcctcagtctcccgtgcatcctcaatgctcggggg
ctgaccagcgtcatcaatcagaagctgaaggacgatgaggtcgctcagctcaggaagagt
gcggacaccctgtgggacatccagaaagacctcaaagacctgtga

KEGG   Mus musculus (mouse): 16833
Entry
16833             CDS       T01002                                 

Gene name
Ldhc, LDH-C4, Ldh, Ldh-, Ldh-3, Ldh-x, Ldh3, Ldhc4
Definition
(RefSeq) lactate dehydrogenase C
  KO
K00016  L-lactate dehydrogenase [EC:1.1.1.27]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00010  Glycolysis / Gluconeogenesis
mmu00270  Cysteine and methionine metabolism
mmu00620  Pyruvate metabolism
mmu00640  Propanoate metabolism
mmu01100  Metabolic pathways
mmu04066  HIF-1 signaling pathway
mmu04922  Glucagon signaling pathway
mmu05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    16833 (Ldhc)
   00620 Pyruvate metabolism
    16833 (Ldhc)
   00640 Propanoate metabolism
    16833 (Ldhc)
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    16833 (Ldhc)
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    16833 (Ldhc)
 09150 Organismal Systems
  09152 Endocrine system
   04922 Glucagon signaling pathway
    16833 (Ldhc)
 09160 Human Diseases
  09161 Cancer: overview
   05230 Central carbon metabolism in cancer
    16833 (Ldhc)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    16833 (Ldhc)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.27  L-lactate dehydrogenase
     16833 (Ldhc)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   16833 (Ldhc)
  Exosomal proteins of breast milk
   16833 (Ldhc)
SSDB
Motif
Pfam: Ldh_1_N Ldh_1_C ThiF Glyco_hydro_4 UDPG_MGDP_dh_N
Other DBs
NCBI-GeneID: 16833
NCBI-ProteinID: NP_038608
MGI: 96764
Ensembl: ENSMUSG00000030851
Vega: OTTMUSG00000027259
UniProt: P00342 Q548Z6
Structure
PDB: 
2LDX

Position
7 B3; 7 30.6 cM
AA seq 332 aa
MSTVKEQLIQNLVPEDKLSRCKITVVGVGNVGMACAISILLKGLADELALVDADTNKLRG
EALDLLHGSLFLSTPKIVFGKDYNVSANSKLVIITAGARMVSGETRLDLLQRNVAIMKAI
VPGIVQNSPDCKIIIVTNPVDILTYVVWKISGFPVGRVIGSGCNLDSARFRYLIGEKLGV
NPTSCHGWVLGEHGDSSVPIWSGVNVAGVTLKSLNPAIGTDSDKEHWKNVHKQVVEGGYE
VLNMKGYTSWAIGLSVTDLARSILKNLKRVHPVTTLVKGFHGIKEEVFLSIPCVLGQSGI
TDFVKVNMTAEEEGLLKKSADTLWNMQKDLQL
NT seq 999 nt   +upstreamnt  +downstreamnt
atgtccaccgtcaaggagcagctgattcagaacctagttccggaagataaactttcccgg
tgtaagattactgtggtcggagttggaaatgtgggcatggcgtgtgctattagtatttta
ctgaagggtttggctgatgaacttgcccttgttgacgctgatacgaacaaactgagggga
gaggcactggatcttctgcacggcagtcttttccttagcactccaaaaatcgtctttgga
aaagattacaatgtatctgccaactccaaactggttattatcacagctggtgcaagaatg
gtgtctggagaaactcgccttgacctgctccaacgtaatgtcgctatcatgaaagccatt
gttccgggcattgtccaaaacagtccggactgtaaaataattatcgtcactaacccagtg
gatattttgacatacgtggtttggaagataagcggcttccctgtaggccgtgtgatcgga
agtggctgtaacctagactcagcacgttttcgttacctgattggggagaagctgggtgtc
aaccctacaagctgccacggctgggttcttggagaacatggggactccagtgtgcccata
tggagtggtgtaaacgttgctggcgtaactctgaagtcactgaacccagcaataggaact
gactcagataaggaacactggaaaaatgttcacaagcaggtggtggaaggcggctatgag
gtccttaacatgaagggctatacctcttgggctatcgggctgtctgtgactgatctggcg
cgatccatcttgaagaatcttaagagagtgcatcctgttaccacgctggttaagggcttc
catgggataaaggaagaggtcttcctcagtatcccttgtgtcttgggacaaagtggtatc
acagactttgtgaaagtcaacatgaccgctgaggaggagggtctcctcaagaagagtgcg
gacacactctggaatatgcagaaggatctgcagttataa

DBGET integrated database retrieval system