KEGG   Mus musculus (mouse): 107029
Entry
107029            CDS       T01002                                 

Gene name
Me2, AW120568, D030040L20Rik, NAD-ME
Definition
(RefSeq) malic enzyme 2, NAD(+)-dependent, mitochondrial
  KO
K00027  malate dehydrogenase (oxaloacetate-decarboxylating) [EC:1.1.1.38]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00620  Pyruvate metabolism
mmu01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    107029 (Me2)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.38  malate dehydrogenase (oxaloacetate-decarboxylating)
     107029 (Me2)
SSDB
Motif
Pfam: Malic_M malic DUF1992
Other DBs
NCBI-GeneID: 107029
NCBI-ProteinID: NP_663469
MGI: 2147351
Ensembl: ENSMUSG00000024556
UniProt: Q99KE1
Position
18; 18 E2
AA seq 589 aa
MFSRLRAVTTPCTLTCRRVHLKEKGKPLMLNPRTNKGMAFTLQERQMLGLQGLLPPKIET
QDIQALRFHRNLKKMTSPLEKYIYIMGIQERNEKLFYRILQDDIESLMPIVYTPTVGLAC
CQYGHIFRRPKGLFISISDRGHVRSIVDNWPENHVKAVVVTDGERILGLGDLGVYGMGIP
VGKLCLYTACAGIQPEKCLPVCIDVGTDNMALLKDPFYMGLYQKRDRSQLYDDLMDEFMK
AITDRYGRNTLIQFEDFGNHNAFRFLRKYQQKYCTFNDDIQGTAAVALSGLLAAQRVINK
PVSEHKILFLGAGEAALGIANLIVLSMVESGLSEEEAQRKIWMFDKSGLLVKGRTASIDS
NQEPYAHAAPESIPATFEDAVNKLKPSVIIGVAGAGPLFTHGVIKAMASINERPIIFALS
NPTAQAECTAEDAYTLTEGRCLFASGSPFEPVKLQDGRVFTPGQGNNAYIFPGVALAVIL
CEARHISDTVFLEAAKALTTQLTDAELAQGRLYPSLANIQEVSANIAIKLAEYLYANKMA
FRYPEPEDKARYVRERIWRSNYVSLLPDVYDWPESSLTPPQITEEKLPH
NT seq 1770 nt   +upstreamnt  +downstreamnt
atgttttcccggctaagagctgttaccactccttgtaccttgacctgccgccgagtgcac
ctgaaagagaagggcaagccactcatgttgaatccaagaacaaacaagggaatggcgttt
acgttacaagagcgacaaatgcttggtcttcaaggacttttacctcctaaaatagagaca
caggatattcaagccttacgattccatagaaacttgaaaaaaatgactagccctttggaa
aaatacatttatataatgggcatccaagaaagaaatgagaaactgttctatagaatcctg
caggatgatattgaaagtctgatgccgattgtgtacacgccaacagttggtcttgcctgc
tgtcaatatgggcacatctttaggagacctaagggattgtttatttcaatctcagacaga
ggtcatgttagatcaattgtggataactggccagaaaatcatgttaaggctgttgtggtg
actgatggagagaggatcctgggccttggcgatctgggtgtctatggaatggggattcca
gtagggaagctgtgcctgtatacagcctgtgcagggatacagcccgagaagtgcctgccc
gtgtgcatcgacgtgggcactgataacatggcactattaaaagatccgttttatatgggc
ttgtatcagaagcgagatcgttcccagctctatgatgatctgatggacgagtttatgaag
gcgattactgacagatacggccggaacacactcattcagtttgaagactttggaaatcat
aatgcattcaggttcttaagaaaatatcaacaaaaatactgtaccttcaatgatgacatt
caagggacagctgcagttgctctgtctggtcttcttgcggcccaaagagttattaataaa
ccagtctcagaacacaaaatcttatttcttggagcaggagaagctgcacttggaattgcc
aatctcatagttctatcaatggtggaaagtggtctctcagaagaggaggcgcagagaaag
atctggatgtttgacaagagtggcttgctggttaaggggcggactgctagcatagatagc
aaccaggaaccatatgcccatgcggccccagagagcatacctgcgacttttgaagatgca
gtaaataaacttaagccttcagttataattggagtggcaggtgccggcccgctttttact
cacggtgtaatcaaagccatggcctctatcaacgagagacctataatatttgctctaagt
aatcctacagcacaggccgagtgcacagccgaggacgcgtacacgctcacagagggcagg
tgtctgtttgccagtggcagcccatttgagccagtgaaactccaggatggacgagtcttc
accccaggccaaggaaacaatgcatatattttcccaggtgtggctttagctgttattctc
tgtgaagcccgacacatcagtgacaccgttttcttagaagctgcaaaggcgctgacgact
cagttgacagatgcagagttagcccaagggaggctttacccgtcgctggctaatattcag
gaagtttctgctaacatagctattaaacttgcagagtacctgtacgctaataaaatggcc
ttccggtacccagaacccgaggacaaggccagatacgtgagagagagaatatggcggagc
aactacgtttccctgctgccggacgtgtatgactggccagagtcttcactgacacctcct
cagatcacagaagagaagcttccccactga

DBGET integrated database retrieval system