KEGG   Mus musculus (mouse): 107239
Entry
107239            CDS       T01002                                 

Symbol
Carns1, AI790298, Atpg, Atpgd1, mKIAA1394
Name
(RefSeq) carnosine synthase 1
  KO
K14755  carnosine synthase [EC:6.3.2.11]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00330  Arginine and proline metabolism
mmu00340  Histidine metabolism
mmu00410  beta-Alanine metabolism
mmu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    107239 (Carns1)
   00340 Histidine metabolism
    107239 (Carns1)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    107239 (Carns1)
Enzymes [BR:mmu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.11  carnosine synthase
     107239 (Carns1)
SSDB
Motif
Pfam: ATPgrasp_Ter ATPgrasp_N ATP-grasp_4 ATP-grasp_3 Sacchrp_dh_NADP
Other DBs
NCBI-GeneID: 107239
NCBI-ProteinID: NP_598909
MGI: 2147595
Ensembl: ENSMUSG00000075289
UniProt: E9PX09
Position
19; 19 A
AA seq 947 aa
MLCLDPLGTEWDSKDLDGKEEPWKSGAGLPPTGCFPGPWRQDISLDCKGSPEETEARAWT
VYYYGLLQSCLQQAGLPETQDRSQAPRTGCPGAEVTLCILGSPSTFLSLLLEGGVQSPGN
MLLCLSPAWLMKVATPGQEGEAVLLVSKAVSFYPGGLTFLDDFVPPRHATYFLAGLGPES
GRGKEAAELARNLTCPTGTSSELSQLLENRLLMRWLLSQQSGVAVPATLAFTYRPPGLLR
GGDASPGLRLVELSGKEGQETLVKEEVEAFVHSEALGDASQVAVRLSGCRWRGQQALPLH
LRVEPSTVVNTVLGLLEKLEEEESVLVEAMCPPVRLPLPGGPAPGPELAVRICAVVCRIQ
GDRPLLSKVVCGVGRGDRPVRHHYTLPRTLRVALAQCGLEEEAQVALLEQGIKEAAEGAL
AAVLALEAGLSVEQRGGRQVHTDFLGVDLVLTVIGRTLTPVVLKLNSGLCLEACGALEGL
WAVPRLRRSAEEAAAAPLVETMLRRSGRHLMDGKQLLVIGAGGVSKKFVWEAARDYGLTL
HLVESDPNHFASQLVQTFIHFDVTEHRRDEENALLLAELVRARNLKLDGCFSFWDDCLVL
TALLCRELGLPCSPPAAMCLAKQKSRTQLHLLRCQGPPWPSTSLHAVACCPLENEADVER
AIYQVPLPGVMKLEFGSGAVGVQLVKDGPQCREHFSRILHDLQGEADHPGIGLGWGNAML
LMEFVEGTEHDVDLVVFGGRLLAAFVSDNGPTRLPGFTETAACMPTGLAPEQEAQVVQAA
FRCCLGCGLLDGVFNVELKMTGAGPRLIEINPRMGGFYLRDWILELYGVDLLLASTMVAC
GLQPALPAHPRARGYLVGIMCLVSQHLQLLSSPSSRETLQTLHDQGQLRLNLLEEALIPG
QYEEPYCNVACAGPSPAEACHRLLGICQGLGIDRPNYPVAHFLSHFK
NT seq 2844 nt   +upstreamnt  +downstreamnt
atgctctgcctggatccactgggtacggagtgggactccaaggacctggatggaaaggaa
gaaccatggaaaagcggtgctggcctgccacccacaggctgcttccctgggccctggcgc
caggatatcagcctggattgcaagggctccccggaagagactgaggctcgggcctggact
gtgtactactacggtctccttcagagttgtctgcagcaagctggccttcctgagacccag
gatcgcagccaggcacctcgtacaggctgccctggggcagaggtgaccttgtgcattctg
ggttctcccagcaccttcctatctctgttgctggagggtggggtccagagccctggaaac
atgctcctttgcctgtcccctgcttggctgatgaaggtggcaactccaggccaagagggt
gaggcagtcctgctggtctctaaggctgtgagcttctatccagggggcctgacattcctg
gatgactttgttccccctcggcatgctacttacttcctggcaggcctggggccagaatct
ggccgtggcaaggaggcagcagagctggctcggaatctcacttgccccacaggaacctca
tcggagctgtcccagctgctggagaaccggctgctgatgaggtggttgctgtcccagcag
agtggtgtggccgtgccagctaccctggctttcacttataggcctccggggctgcttcgg
ggaggggatgccagccctggactccggctggtggaactcagtgggaaggagggccaggaa
acactggtgaaagaggaagtagaggcctttgtgcactccgaggccttgggtgatgcttca
caggtggctgtgaggctcagtggctgtcgctggcgtggacagcaggcattgcctctgcac
ctgcgggtagagccatccacagtggtgaacacggtgctgggattgctggagaagctggag
gaggaggagagtgtccttgtggaggccatgtgcccacctgtccggctgcccttaccaggc
ggtcctgcacctggccctgagctggctgtgcgtatctgtgcagtggtgtgtcggattcag
ggtgataggcccctactgagtaaggtggtgtgtggcgtgggccgtggggatcgacccgtg
cggcaccactataccctgccaaggacactgagggtggcgctggctcagtgtggcctggaa
gaggaggcgcaggtggcgcttctggagcagggcatcaaagaagcagccgaaggcgcgttg
gccgctgtgctggccctggaggctggactgagtgtggagcagcgtggtggacgccaagtg
cacaccgacttcctcggcgtggacttagttctcacggtgatcggacgcacgctgacgccc
gtggtccttaagctgaacagtggcctgtgcctagaggcctgcggcgcgctcgaggggctg
tgggccgtgccacgcctaagacgctcagctgaggaggcagcggcagcgccgctggtggag
actatgctgcggcgctcagggcgccacctcatggacggcaagcagctgctggtgatcggc
gccggcggcgtcagcaagaagttcgtgtgggaggcggcgcgggactacggactgacgctg
cacctggtggaatcagaccccaaccactttgcatcccaactggtacagacctttatccac
tttgatgtgactgagcaccggagggatgaggagaatgcgctgctgctggctgagctggta
cgggcccggaacctgaagctagatggctgcttctccttctgggatgactgcttggtgctt
actgctctcctctgccgtgagctgggtctgccctgcagccccccagctgccatgtgcttg
gcaaagcagaagagccgcacacagctacatctgttgcggtgccagggcccaccctggcct
tcgacctctctccatgctgtggcctgttgcccattggagaatgaggctgatgtggagaga
gccatttaccaggtacccctgccaggtgtgatgaaactggaatttgggtcaggagcagta
ggcgtgcagctggtgaaggatgggccccagtgccgtgagcacttttcccggatcctccat
gacctgcagggtgaggctgaccaccctggcatcgggctgggctggggcaatgctatgctg
ctgatggagtttgttgagggcacagagcatgacgtggacctggtggtgttcggtggacgg
ttgctggctgctttcgtctccgataatggccccacaaggctgcctggcttcacagagact
gcagcctgcatgcccactgggctagcaccagagcaggaggcccaggtggtgcaggcagcc
tttcgctgctgcctgggctgtgggctgctggatggggttttcaatgtggagctcaagatg
actggggctgggccaaggctcatcgagattaaccctcgaatgggaggcttctaccttcga
gactggatcctagagctctatggtgtggatttgcttctggcttctacaatggtggcctgt
ggcctgcagcctgccttgcctgctcaccctcgtgcccgtggctacctagtgggcatcatg
tgcctggtgtcccagcacctacagctgctgagttccccgagcagtagagagactctgcaa
accctccatgaccaggggcaattacgactcaacctgctggaggaggccctgatacctggc
cagtatgaggagccctactgcaatgtggcctgtgctgggcccagccctgctgaggcctgt
caccgcctgctaggcatctgtcagggcttgggcattgacaggcccaactaccctgttgcc
catttcctgtctcatttcaaatag

DBGET integrated database retrieval system