KEGG   Mus musculus (house mouse): 108664
Entry
108664            CDS       T01002                                 
Symbol
Atp6v1h, 0710001F19Rik, AU022349, CGI-11, SFD, SFDalpha, SFDbeta, VMA13
Name
(RefSeq) ATPase, H+ transporting, lysosomal V1 subunit H
  KO
K02144  V-type H+-transporting ATPase subunit H
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu00190  Oxidative phosphorylation
mmu01100  Metabolic pathways
mmu04142  Lysosome
mmu04145  Phagosome
mmu04150  mTOR signaling pathway
mmu04721  Synaptic vesicle cycle
mmu05152  Tuberculosis
mmu05165  Human papillomavirus infection
mmu05323  Rheumatoid arthritis
Module
mmu_M00160  V-type ATPase, eukaryotes
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    108664 (Atp6v1h)
 09130 Environmental Information Processing
  09132 Signal transduction
   04150 mTOR signaling pathway
    108664 (Atp6v1h)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    108664 (Atp6v1h)
   04142 Lysosome
    108664 (Atp6v1h)
 09150 Organismal Systems
  09156 Nervous system
   04721 Synaptic vesicle cycle
    108664 (Atp6v1h)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    108664 (Atp6v1h)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    108664 (Atp6v1h)
  09163 Immune disease
   05323 Rheumatoid arthritis
    108664 (Atp6v1h)
SSDB
Motif
Pfam: V-ATPase_H_N V-ATPase_H_C Arm Arm_2 HEAT DUF2326 UCH
Other DBs
NCBI-GeneID: 108664
NCBI-ProteinID: NP_598587
MGI: 1914864
Ensembl: ENSMUSG00000033793
Vega: OTTMUSG00000050145
UniProt: Q8BVE3
Position
1:5153201..5233438
AA seq 483 aa
MTKMDIRGAVDAAVPTNIIAAKAAEVRANKVNWQSYLQGQMISAEDCEFIQRFEMKRSSE
DKQEMLQTEGSQCAKTFINLMTHISKEQTVQYILTMVDDMLQENHQRVSIFFDYAKRSKS
TAWPYFLPMLNRQDPFTVHMAARIIAKLAAWGKELMEGSDLNYYFNWIKTQLSSQKLRGS
GVAVETGTISSSDSSQYVQCVAGCLQLMLRVNEYRFAWVEADGVNCIMGVLSNKCGFQLQ
YQMIFSIWLLAFSPQMCEHLRRYNIIPVLSDILQESVKEKVTRIILAAFRNFLEKSTERE
TRQEYALAMIQCKVLKQLENLEQQKYDDEDISEDIKFLLEKLGESVQDLSSFDEYSSELK
SGRLEWSPVHKSEKFWRENAVRLNEKNYELLKILTKLLEVSDDPQVLAVAAHDVGEYVRH
YPRGKRVIEQLGGKQLVMNHMHHEDQQVRYNALLAVQKLMVHNWEYLGKQLQSEQPQTAA
ARS
NT seq 1452 nt   +upstreamnt  +downstreamnt
atgaccaagatggacattcgaggtgctgtggatgctgctgtcccaactaacatcattgcg
gccaaggctgctgaagttcgtgccaacaaagtgaactggcagtcttatcttcaggggcag
atgatttctgctgaagattgtgaatttattcaaaggtttgaaatgaaaagaagttccgag
gacaagcaagagatgcttcaaactgaaggcagccagtgtgctaaaacatttataaatctg
atgacgcacatctccaaagaacagacagtgcagtacatactaaccatggttgacgatatg
ctgcaggaaaatcaccagcgtgtcagcattttctttgactatgcgaaacgaagcaagagc
actgcctggccatacttcctgccaatgttgaatcgccaggatccctttactgttcatatg
gcagcaagaattatcgccaagttagctgcttgggggaaagaactgatggaaggcagtgac
ttaaattactatttcaattggataaaaactcagctgagttcacagaaacttcgtggcagc
ggtgttgctgttgaaacaggaacaatctcttcaagtgatagttctcagtatgtgcagtgt
gttgctggctgtctgcagctgatgctccgggtcaatgagtaccggtttgcctgggtagaa
gcagatggagtgaactgtataatgggcgttttgagtaacaagtgtggttttcaacttcaa
taccaaatgattttttcaatatggctcctggcattcagtcctcaaatgtgtgagcacctt
cgtcgctataatatcattcctgttctatcagacatccttcaagaatctgtcaaagagaaa
gtaacaagaatcattcttgcagcattccggaatttcttagaaaaatcaacggaaagagaa
actcgccaagagtatgctctggctatgattcaatgcaaagtactgaaacagttggagaat
ttggagcagcagaagtatgatgatgaagatatcagtgaagacatcaaatttcttttggaa
aaacttggtgagagtgtccaggaccttagctcatttgatgaatacagttcagaacttaaa
tctggaagattggaatggagccctgtacacaagtctgagaaattttggagagaaaatgcc
gtgaggttgaatgagaagaactatgaactcttgaaaatcttgacaaaacttctggaggta
tcagatgatccacaagtcttagctgttgctgctcacgatgttggagaatatgtccggcat
tatccccggggaaaacgggttattgagcagcttggtggaaagcagttggtgatgaaccac
atgcaccatgaagaccagcaggttcgctacaatgctcttctggccgtgcagaagctcatg
gtgcacaactgggaatatcttggtaaacaactacagtcagagcagcctcagactgctgct
gctcggagctga

KEGG   Mus musculus (house mouse): 110935
Entry
110935            CDS       T01002                                 
Symbol
Atp6v1b1, AW208839, Atp6b1, D630003L15, D630030L16Rik, D630039P21Rik, Vpp-3, Vpp3
Name
(RefSeq) ATPase, H+ transporting, lysosomal V1 subunit B1
  KO
K02147  V-type H+-transporting ATPase subunit B
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu00190  Oxidative phosphorylation
mmu01100  Metabolic pathways
mmu04145  Phagosome
mmu04150  mTOR signaling pathway
mmu04721  Synaptic vesicle cycle
mmu04966  Collecting duct acid secretion
mmu05165  Human papillomavirus infection
mmu05323  Rheumatoid arthritis
Module
mmu_M00160  V-type ATPase, eukaryotes
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    110935 (Atp6v1b1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04150 mTOR signaling pathway
    110935 (Atp6v1b1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    110935 (Atp6v1b1)
 09150 Organismal Systems
  09155 Excretory system
   04966 Collecting duct acid secretion
    110935 (Atp6v1b1)
  09156 Nervous system
   04721 Synaptic vesicle cycle
    110935 (Atp6v1b1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    110935 (Atp6v1b1)
  09163 Immune disease
   05323 Rheumatoid arthritis
    110935 (Atp6v1b1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    110935 (Atp6v1b1)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   110935 (Atp6v1b1)
SSDB
Motif
Pfam: ATP-synt_ab ATP-synt_ab_N
Other DBs
NCBI-GeneID: 110935
NCBI-ProteinID: NP_598918
MGI: 103285
Ensembl: ENSMUSG00000006269
Vega: OTTMUSG00000058015
UniProt: Q91YH6
Position
6:83719999..83735837
AA seq 513 aa
MATTVDSRSSGFTGNSCDPGTAQEHVQAVTRNYITHPRVTYRTVCSVNGPLVVLDQVKFA
QYAEIVNFTLPDGTQRSGQVLEVAGTKAIVQVFEGTSGIDSQKTTCEFTGDILRTPVSED
MLGRIFNGSGKPIDKGPAVMAEEFLDINGQPINPHDRIYPEEMIQTGISPIDVMNSIARG
QKIPIFSAAGLPHNEIAAQICRQAGLVKKSKAVLDYHEDNFAIVFAAMGVNMETARFFKS
DFEQNGTMGNVCLFLNLANDPTIERIITPRLALTTAEFLAYQCEKHVLVILTDMSSYAEA
LREVSAAREEVPGRRGFPGYMYTDLATIYERAGRVEGRGGSITQIPILTMPNDDITHPIP
DLTGFITEGQIYVDRQLHNRQVYPPINVLPSLSRLMKSAIGEGMTRKDHGDVSNQLYACY
AIGKDVQAMKAVVGEEALTSEDLLYLEFLQKFEKNFITQGPYENRTVFESLDLGWKLLRI
FPKEMLKRIPQSMTDEFYSRQGAQQDPASDTAL
NT seq 1542 nt   +upstreamnt  +downstreamnt
atggccacaacagtagacagcaggtcctcgggattcactggcaatagctgtgacccaggc
acagcccaagagcatgtgcaggctgtgacccgaaactacatcacccacccccgagtcacc
tataggacagtgtgcagcgtcaatgggcctctggtggtgctggaccaggtcaagtttgcc
cagtatgctgagattgtcaactttaccctccctgatggtactcagaggagtggccaggtg
cttgaagtggctgggaccaaggccattgttcaggtgtttgaagggacttcagggattgat
tcccagaagaccacatgtgaattcacaggggacatcctgcggactcctgtgtcagaagac
atgctgggtcggattttcaatggctctggcaaacccattgacaaaggacctgctgtcatg
gcagaggagtttctggacatcaatggccagccaatcaatccccatgaccgaatctacccc
gaggagatgatccagacgggaatctcccccattgatgtcatgaacagcatcgctcgtggc
cagaagatccccatcttctctgcggctgggctcccccacaatgagattgcagcccagatc
tgccgccaagccgggctggtgaagaaatccaaggctgtgctggattatcatgaagacaac
ttcgccattgtctttgcagccatgggggtgaacatggagacagccaggttcttcaagtca
gatttcgagcagaatggaaccatgggaaatgtctgtctcttcctgaatttggccaatgac
cctacgattgagcggatcatcacgccacgtctggcactgaccacggctgagttccttgcc
taccagtgtgagaagcacgtgctggtgatactgactgacatgagctcctatgcggaggcc
ttgcgggaggtctcagctgcccgggaggaagtgccaggacgccgtggctttcctggatat
atgtacacagacttggccaccatctatgagcgagctggccgtgtggagggccggggtggt
tccatcacccagatccccattctcaccatgcctaatgatgatatcacccatcccatccca
gacttgactggcttcatcacagaggggcagatttatgtggaccgacagctacataaccgg
caggtctacccacccatcaatgtgctcccatccctctcgcgactgatgaagtcggccata
ggcgagggcatgaccagaaaggaccacggagatgtctccaaccagctgtacgcctgctac
gccatcgggaaggacgtgcaggccatgaaagcggtggtgggggaggaggcgctcacctcc
gaggacctgctctacctggagttcctgcagaagtttgagaagaatttcatcacccaaggt
ccttacgagaaccgcacggtgttcgagtcgctggacctgggctggaaactgctgcgcatc
tttccgaaagagatgctgaagcgcattccgcagagcatgacggacgagttctactctcgc
cagggggcgcagcaggaccccgcatccgacacggcgctctaa

KEGG   Mus musculus (house mouse): 114143
Entry
114143            CDS       T01002                                 
Symbol
Atp6v0b, 2310024H13Rik, Atp6f, VMA16
Name
(RefSeq) ATPase, H+ transporting, lysosomal V0 subunit B
  KO
K03661  V-type H+-transporting ATPase 21kDa proteolipid subunit
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu00190  Oxidative phosphorylation
mmu01100  Metabolic pathways
mmu04142  Lysosome
mmu04145  Phagosome
mmu04721  Synaptic vesicle cycle
mmu05152  Tuberculosis
mmu05165  Human papillomavirus infection
mmu05323  Rheumatoid arthritis
Module
mmu_M00160  V-type ATPase, eukaryotes
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    114143 (Atp6v0b)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    114143 (Atp6v0b)
   04142 Lysosome
    114143 (Atp6v0b)
 09150 Organismal Systems
  09156 Nervous system
   04721 Synaptic vesicle cycle
    114143 (Atp6v0b)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    114143 (Atp6v0b)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    114143 (Atp6v0b)
  09163 Immune disease
   05323 Rheumatoid arthritis
    114143 (Atp6v0b)
SSDB
Motif
Pfam: ATP-synt_C
Other DBs
NCBI-GeneID: 114143
NCBI-ProteinID: NP_291095
MGI: 1890510
Ensembl: ENSMUSG00000033379
Vega: OTTMUSG00000008663
UniProt: Q91V37 Q3U889
Position
4:complement(117741523..117744548)
AA seq 205 aa
MTGLELLYLGIFVAFWACMVVVGICYTIFDLGFRFDVAWFLTETSPFMWSNLGIGLAISL
SVVGAAWGIYITGSSIIGGGVKAPRIKTKNLVSIIFCEAVAIYGIIMAIVISNMAEPFSA
TEPKAIGHRNYHAGYSMFGAGLTVGLSNLFCGVCVGIVGSGAALADAQNPSLFVKILIVE
IFGSAIGLFGVIVAILQTSRVKMGD
NT seq 618 nt   +upstreamnt  +downstreamnt
atgacggggctggagttgctctacctcgggatctttgtggccttctgggcctgcatggtc
gttgtgggaatctgctacaccatctttgacctgggctttcgctttgatgtggcatggttc
ctgacggaaacttcccccttcatgtggtcgaatctgggcattggcctagcaatttctctg
tctgtggttggagcagcctggggaatctatataaccggctcatccattattgggggtggg
gtgaaagcccccagaatcaaaaccaagaacttggttagtattatcttctgtgaagcggtg
gccatctatggcatcatcatggcaattgtcatcagcaacatggctgagcctttcagtgct
acggagcccaaggccattggccatcgaaactaccatgcaggttactccatgtttggggct
ggcctcacagtcggtctgtccaacctgttctgtggagtctgcgtgggcatcgtgggcagt
ggggccgccctggcggatgcacagaaccccagcctctttgtaaaaattctcatcgtggag
atctttggcagtgccattggcctctttggggtcattgttgcaatccttcagacctccaga
gtgaagatgggtgactag

KEGG   Mus musculus (house mouse): 11964
Entry
11964             CDS       T01002                                 
Symbol
Atp6v1a, AI647066, Atp6a1, Atp6a2, Atp6v1a1, VA68, VPP2
Name
(RefSeq) ATPase, H+ transporting, lysosomal V1 subunit A
  KO
K02145  V-type H+-transporting ATPase subunit A [EC:7.1.2.2]
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu00190  Oxidative phosphorylation
mmu01100  Metabolic pathways
mmu04145  Phagosome
mmu04150  mTOR signaling pathway
mmu04721  Synaptic vesicle cycle
mmu04966  Collecting duct acid secretion
mmu05165  Human papillomavirus infection
mmu05323  Rheumatoid arthritis
Module
mmu_M00160  V-type ATPase, eukaryotes
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    11964 (Atp6v1a)
 09130 Environmental Information Processing
  09132 Signal transduction
   04150 mTOR signaling pathway
    11964 (Atp6v1a)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    11964 (Atp6v1a)
 09150 Organismal Systems
  09155 Excretory system
   04966 Collecting duct acid secretion
    11964 (Atp6v1a)
  09156 Nervous system
   04721 Synaptic vesicle cycle
    11964 (Atp6v1a)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    11964 (Atp6v1a)
  09163 Immune disease
   05323 Rheumatoid arthritis
    11964 (Atp6v1a)
Enzymes [BR:mmu01000]
 7. Translocases
  7.1  Catalysing the translocation of hydrons
   7.1.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.1.2.2  H+-transporting two-sector ATPase
     11964 (Atp6v1a)
SSDB
Motif
Pfam: ATP-synt_ab ATP-synt_ab_Xtn ATP-synt_ab_N
Other DBs
NCBI-GeneID: 11964
NCBI-ProteinID: NP_031534
MGI: 1201780
Ensembl: ENSMUSG00000052459
Vega: OTTMUSG00000023485
UniProt: P50516
Position
16:complement(43905765..43960064)
AA seq 617 aa
MDFSKLPKIRDEDKESTFGYVHGVSGPVVTACDMAGAAMYELVRVGHSELVGEIIRLEGD
MATIQVYEETSGVSVGDPVLRTGKPLSVELGPGIMGAIFDGIQRPLSDISSQTQSIYIPR
GVNVSALSRDIKWEFIPSKNLRVGSHITGGDIYGIVNENSLIKHKIMLPPRNRGSVTYIA
PPGNYDASDVVLELEFEGVKEKFSMVQVWPVRQVRPVTEKLPANHPLLTGQRVLDALFPC
VQGGTTAIPGAFGCGKTVISQSLSKYSNSDVIIYVGCGERGNEMSEVLRDFPELTMEVDG
KVESIMKRTALVANTSNMPVAAREASIYTGITLSEYFRDMGYHVSMMADSTSRWAEALRE
ISGRLAEMPADSGYPAYLGARLASFYERAGRVKCLGNPEREGSVSIVGAVSPPGGDFSDP
VTSATLGIVQVFWGLDKKLAQRKHFPSVNWLISYSKYMRALDEYYDKHFTEFVPLRTKAK
EILQEEEDLAEIVQLVGKASLAETDKITLEVAKLIKDDFLQQNGYTPYDRFCPFYKTVGM
LSNMISFYDMARRAVETTAQSDNKITWSIIREHMGEILYKLSSMKFKDPVKDGEAKIKAD
YAQLLEDMQNAFRSLED
NT seq 1854 nt   +upstreamnt  +downstreamnt
atggatttctccaagctacccaaaatccgagatgaggataaagaaagtacatttggttat
gtgcatggagtctcagggcctgtggttacagcctgtgacatggcgggcgctgccatgtac
gagctggtgagagtggggcacagcgagctggttggagaaattattcgattggaaggtgac
atggccaccattcaggtgtatgaagaaacttctggtgtctctgttggagaccccgtactc
cgcactggtaaacctctctcggtcgagctgggtcccgggattatgggagccatttttgat
ggtatacagagacctctgtcggatatcagcagtcagacccaaagtatctacatccccaga
ggagtcaatgtgtctgctctcagcagagatatcaaatgggagtttatacccagcaaaaac
ctacgggttggtagtcatatcactggtggagacatttatgggattgtcaatgagaactcc
ctcatcaaacacaaaatcatgttgcccccacgtaacagaggaagcgtgacttacatcgcg
ccgcctgggaattatgatgcatccgatgtcgtcctggagcttgagtttgaaggtgtgaag
gagaagttcagcatggtccaagtgtggcctgtgcggcaggtgcggcctgtcactgagaag
ctgcccgccaatcaccccttgcttactggccagagagtcctcgatgcccttttcccgtgt
gttcagggaggaactactgctatcccaggcgcctttggctgtggaaagactgtgatttcc
cagtctctatccaagtactccaacagtgacgtcatcatctatgtcggctgcggtgagaga
ggcaacgagatgtcagaagttctccgcgacttccctgagctcaccatggaggttgatggg
aaagtagagtccatcatgaagaggacagcgctggtagccaacacctccaacatgcctgtg
gctgcgagagaggcctccatctacactggaattacactatcagaatatttccgtgacatg
ggctaccacgtcagtatgatggccgactctacctctagatgggctgaggccctcagagaa
atctctggtcgcttagctgagatgcctgcagatagtggataccctgcataccttggtgcc
cggctggcttctttctatgagcgagcaggcagagtgaaatgtctcggaaaccctgagaga
gaagggagtgtcagcattgtaggagcagtttctccacctggtggtgatttttctgatcca
gtcacttctgcaacgctgggtattgttcaggtgttctggggcttggataagaagttagct
cagcgcaagcacttcccctctgtcaactggctcatcagctacagcaagtacatgcgtgcc
ctggacgagtactatgacaagcacttcacggagtttgttcctctgaggaccaaagctaag
gagatcctgcaggaagaagaggatctggcagaaatcgtgcagctcgtgggaaaggcctct
ttagcagagacggataaaatcactctggaggtagcaaaacttattaaagatgacttccta
cagcaaaatgggtacactccttatgacaggttctgtccattctacaagacagtggggatg
ctgtccaacatgatttcattctatgacatggcccgccgagctgtggagaccactgcccag
agtgacaataagatcacatggtccattatccgggagcacatgggggagattctctataaa
ctctcctccatgaaattcaaggatccagtgaaagatggcgaggcaaagatcaaggccgac
tatgcacagcttcttgaagatatgcagaatgcattccgtagccttgaagactag

KEGG   Mus musculus (house mouse): 11966
Entry
11966             CDS       T01002                                 
Symbol
Atp6v1b2, AI194269, AI790362, Atp6b2, HO57, R74844
Name
(RefSeq) ATPase, H+ transporting, lysosomal V1 subunit B2
  KO
K02147  V-type H+-transporting ATPase subunit B
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu00190  Oxidative phosphorylation
mmu01100  Metabolic pathways
mmu04145  Phagosome
mmu04150  mTOR signaling pathway
mmu04721  Synaptic vesicle cycle
mmu04966  Collecting duct acid secretion
mmu05165  Human papillomavirus infection
mmu05323  Rheumatoid arthritis
Module
mmu_M00160  V-type ATPase, eukaryotes
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    11966 (Atp6v1b2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04150 mTOR signaling pathway
    11966 (Atp6v1b2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    11966 (Atp6v1b2)
 09150 Organismal Systems
  09155 Excretory system
   04966 Collecting duct acid secretion
    11966 (Atp6v1b2)
  09156 Nervous system
   04721 Synaptic vesicle cycle
    11966 (Atp6v1b2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    11966 (Atp6v1b2)
  09163 Immune disease
   05323 Rheumatoid arthritis
    11966 (Atp6v1b2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    11966 (Atp6v1b2)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   11966 (Atp6v1b2)
SSDB
Motif
Pfam: ATP-synt_ab ATP-synt_ab_N DUF2481
Other DBs
NCBI-GeneID: 11966
NCBI-ProteinID: NP_031535
MGI: 109618
Ensembl: ENSMUSG00000006273
Vega: OTTMUSG00000025651
UniProt: P62814
Position
8:69541388..69566370
AA seq 511 aa
MALRAMRGIVNGAAPELPVPTGGPMAGAREQALAVSRNYLSQPRLTYKTVSGVNGPLVIL
DHVKFPRYAEIVHLTLPDGTKRSGQVLEVSGSKAVVQVFEGTSGIDAKKTSCEFTGDILR
TPVSEDMLGRVFNGSGKPIDRGPVVLAEDFLDIMGQPINPQCRIYPEEMIQTGISAIDGM
NSIARGQKIPIFSAAGLPHNEIAAQICRQAGLVKKSKDVVDYSEENFAIVFAAMGVNMET
ARFFKSDFEENGSMDNVCLFLNLANDPTIERIITPRLALTTAEFLAYQCEKHVLVILTDM
SSYAEALREVSAAREEVPGRRGFPGYMYTDLATIYERAGRVEGRNGSITQIPILTMPNDD
ITHPIPDLTGYITEGQIYVDRQLHNRQIYPPINVLPSLSRLMKSAIGEGMTRKDHADVSN
QLYACYAIGKDVQAMKAVVGEEALTSDDLLYLEFLQKFEKNFITQGPYENRTVYETLDIG
WQLLRIFPKEMLKRIPQSTLSEFYPRDSAKH
NT seq 1536 nt   +upstreamnt  +downstreamnt
atggcgttgcgagcgatgcggggaatcgtgaacggggccgcacccgaactgcccgtgccc
accggtgggccgatggccggagctcgggagcaggcgctggcggtgagccggaactaccta
tcccagcctcgtctcacctacaagactgtctctggggtgaatggtccactagtgatccta
gatcatgtgaagtttcccagatacgctgagattgtccacttgacattaccagatggcaca
aagagaagtgggcaagtcctagaagttagtggctccaaagcagtggttcaggtatttgaa
gggacatctggtatagacgccaagaaaacatcctgtgagtttactggagatattctccga
acaccagtgtctgaggatatgcttggtcgagtattcaacggatcaggaaaacccattgac
cgaggccctgtggtgctggctgaagacttccttgacatcatgggtcagccaatcaaccct
cagtgtcggatctatccagaagagatgattcagacgggcatttccgccatcgatggcatg
aacagtattgctaggggacagaaaatccccatcttttctgctgctggattaccacacaac
gagattgcagctcagatctgtcgccaggctggtttggtaaagaaatccaaagatgtagtg
gactatagtgaagaaaattttgccattgtgtttgctgctatgggagtaaacatggaaaca
gcccggttctttaaatctgactttgaagaaaatggctcaatggacaatgtctgccttttt
ttgaatctggctaatgacccaaccattgagcggatcatcactcctcgcctggctctgacc
acggccgagtttctggcatatcagtgtgagaagcacgtgctggtgatcctgacggacatg
agctcctacgctgaagcgctgcgagaggtttcagctgccagggaagaggtccctggtcgg
cgaggcttcccaggctacatgtataccgacttagccacaatctatgaacgtgccggtcga
gtggaaggtagaaacggctctattacccaaatccctattctcaccatgcccaatgacgat
atcactcatcccatccctgacttgactgggtacattactgagggccagatctatgtggac
agacagctgcacaacagacagatttaccctcctattaatgtgctgccctcactctctcgg
ttaatgaagtcagctatcggagaaggaatgaccagaaaggatcacgctgatgtgtctaac
cagttgtatgcgtgctatgccatcggtaaggacgtgcaagccatgaaagccgtggtggga
gaggaagccctgacctcagatgatctcctttacctggaatttctgcagaagtttgagaag
aacttcattactcagggtccctatgaaaaccgaactgtttatgagactttggacattggc
tggcagttgcttcgaatcttccccaaagaaatgctgaagagaatccctcagagcaccctg
agcgaattttaccctcgagactctgcaaaacactag

KEGG   Mus musculus (house mouse): 11972
Entry
11972             CDS       T01002                                 
Symbol
Atp6v0d1, AI267038, Ac39, Atp6d, P39, VATX, Vma6
Name
(RefSeq) ATPase, H+ transporting, lysosomal V0 subunit D1
  KO
K02146  V-type H+-transporting ATPase subunit d
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu00190  Oxidative phosphorylation
mmu01100  Metabolic pathways
mmu04142  Lysosome
mmu04145  Phagosome
mmu04721  Synaptic vesicle cycle
mmu04966  Collecting duct acid secretion
mmu05152  Tuberculosis
mmu05165  Human papillomavirus infection
mmu05203  Viral carcinogenesis
mmu05323  Rheumatoid arthritis
Module
mmu_M00160  V-type ATPase, eukaryotes
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    11972 (Atp6v0d1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    11972 (Atp6v0d1)
   04142 Lysosome
    11972 (Atp6v0d1)
 09150 Organismal Systems
  09155 Excretory system
   04966 Collecting duct acid secretion
    11972 (Atp6v0d1)
  09156 Nervous system
   04721 Synaptic vesicle cycle
    11972 (Atp6v0d1)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    11972 (Atp6v0d1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    11972 (Atp6v0d1)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    11972 (Atp6v0d1)
  09163 Immune disease
   05323 Rheumatoid arthritis
    11972 (Atp6v0d1)
SSDB
Motif
Pfam: vATP-synt_AC39 Nab2p_Zf1
Other DBs
NCBI-GeneID: 11972
NCBI-ProteinID: NP_038505
MGI: 1201778
Ensembl: ENSMUSG00000013160
Vega: OTTMUSG00000032456
UniProt: P51863
Position
8:complement(106251093..106292696)
AA seq 351 aa
MSFFPELYFNVDNGYLEGLVRGLKAGVLSQADYLNLVQCETLEDLKLHLQSTDYGNFLAN
EASPLTVSVIDDKLKEKMVVEFRHMRNHAYEPLASFLDFITYSYMIDNVILLITGTLHQR
SIAELVPKCHPLGSFEQMEAVNIAQTPAELYNAILVDTPLAAFFQDCISEQDLDEMNIEI
IRNTLYKAYLESFYKFCTLLGGTTADAMCPILEFEADRRAFIITINSFGTELSKEDRAKL
FPHCGRLYPEGLAQLARADDYEQVKNVADYYPEYKLLFEGAGSNPGDKTLEDRFFEHEVK
LNKLAFLNQFHFGVFYAFVKLKEQECRNIVWIAECIAQRHRAKIDNYIPIF
NT seq 1056 nt   +upstreamnt  +downstreamnt
atgtcgttcttcccggagctctatttcaacgtggacaatggctacttggagggattagtg
cgcggcctgaaggccggggtgctcagccaggcggactacctcaacctggtgcagtgcgag
acgctcgaggacttgaagctgcacctacagagtacagattatggcaacttcctggccaat
gaagcgtcacctctgacggtgtcagtcatcgatgacaagctcaaggagaagatggtagta
gagttccgccacatgagaaaccatgcttatgagccgctcgccagcttcctggacttcata
acttatagctacatgattgacaacgtgatcctgctaatcacaggcacactgcaccagcgt
tcaatagctgaacttgtgcccaagtgccatccgctaggcagctttgagcagatggaggct
gtgaacatcgcacagacacctgcagagctctacaatgccattctggtggacacacccctg
gcggcttttttccaggactgcatctcagagcaggaccttgatgagatgaacatcgagata
atccgaaatacgctttacaaggcctacttggagtccttctacaagttctgtactctgttg
ggtgggaccacagctgatgccatgtgtcctatcctagagtttgaagcagaccgccgcgct
ttcatcatcaccatcaactctttcggcacagagctgtccaaggaggaccgtgccaagctc
ttcccgcactgtggccggctctaccctgagggcttggctcagctggcgcgggctgatgac
tatgaacaggtcaagaatgtagctgattactacccggaatacaaactgctttttgagggt
gcaggtagcaatcctggagacaagaccctggaggaccggttttttgaacatgaggtgaag
ctaaacaagctggccttcctgaaccagttccattttggtgtcttttatgcctttgtgaag
cttaaggaacaggaatgtcgcaacatcgtatggattgctgagtgcattgcccagcgccat
cgcgccaagatcgacaactacatccccatcttttag

KEGG   Mus musculus (house mouse): 11973
Entry
11973             CDS       T01002                                 
Symbol
Atp6v1e1, 2410029D23Rik, Atp6e, Atp6e2, Atp6v1e, D6Ertd385e, Vma4, p31
Name
(RefSeq) ATPase, H+ transporting, lysosomal V1 subunit E1
  KO
K02150  V-type H+-transporting ATPase subunit E
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu00190  Oxidative phosphorylation
mmu01100  Metabolic pathways
mmu04145  Phagosome
mmu04150  mTOR signaling pathway
mmu04721  Synaptic vesicle cycle
mmu04966  Collecting duct acid secretion
mmu05165  Human papillomavirus infection
mmu05323  Rheumatoid arthritis
Module
mmu_M00160  V-type ATPase, eukaryotes
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    11973 (Atp6v1e1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04150 mTOR signaling pathway
    11973 (Atp6v1e1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    11973 (Atp6v1e1)
 09150 Organismal Systems
  09155 Excretory system
   04966 Collecting duct acid secretion
    11973 (Atp6v1e1)
  09156 Nervous system
   04721 Synaptic vesicle cycle
    11973 (Atp6v1e1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    11973 (Atp6v1e1)
  09163 Immune disease
   05323 Rheumatoid arthritis
    11973 (Atp6v1e1)
SSDB
Motif
Pfam: vATP-synt_E DUF4288 NifW
Other DBs
NCBI-GeneID: 11973
NCBI-ProteinID: NP_031536
MGI: 894326
Ensembl: ENSMUSG00000019210
Vega: OTTMUSG00000056828
UniProt: P50518
Position
6:complement(120772205..120799659)
AA seq 226 aa
MALSDADVQKQIKHMMAFIEQEANEKAEEIDAKAEEEFNIEKGRLVQTQRLKIMEYYEKK
EKQIEQQKKIQMSNLMNQARLKVLRARDDLITDLLNEAKQRLSKVVKDTTRYQVLLDGLV
LQGLYQLLEPRMIVRCRKQDFPLVKAAVQKAIPMYKIATKKDVDVQIDQEAYLPEEIAGG
VEIYNGDRKIKVSNTLESRLDLIAQQMMPEVRGALFGANANRKFLD
NT seq 681 nt   +upstreamnt  +downstreamnt
atggcgctcagcgatgcagatgtacagaagcagattaagcacatgatggctttcattgaa
caagaagccaatgagaaagcagaagaaatagatgcaaaggcagaagaagagttcaacatt
gagaaaggtcgccttgtgcaaacgcaaagactgaagattatggaatactacgagaagaaa
gaaaagcagattgagcagcagaagaaaattcagatgtccaacttgatgaatcaagcaagg
ctcaaagtcctcagagcaagggatgacctcatcactgatctgctaaatgaggcaaagcag
agactcagtaaggtggtaaaagatacgacccgttaccaagtgctgctggatgggctggtc
cttcagggcttgtaccagctgctggagcctcgaatgatcgtgcgttgcagaaaacaagat
ttccctttggtgaaggccgcagtacaaaaagcaatccctatgtataaaattgctaccaaa
aaggatgttgatgtccagattgaccaggaggcctacctgcctgaggaaatagctggtggc
gttgagatctataatggggatcgcaagataaaggtttccaacaccctggaaagccggctg
gacctgatagcccagcagatgatgccagaagtccgtggagccttgtttggtgcaaatgcc
aataggaagtttctggactga

KEGG   Mus musculus (house mouse): 11974
Entry
11974             CDS       T01002                                 
Symbol
Atp6v0e, Atp6k, Atp6v0e1, M9.2
Name
(RefSeq) ATPase, H+ transporting, lysosomal V0 subunit E
  KO
K02153  V-type H+-transporting ATPase subunit e
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu00190  Oxidative phosphorylation
mmu01100  Metabolic pathways
mmu04145  Phagosome
mmu04721  Synaptic vesicle cycle
mmu04966  Collecting duct acid secretion
mmu05165  Human papillomavirus infection
mmu05323  Rheumatoid arthritis
Module
mmu_M00160  V-type ATPase, eukaryotes
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    11974 (Atp6v0e)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    11974 (Atp6v0e)
 09150 Organismal Systems
  09155 Excretory system
   04966 Collecting duct acid secretion
    11974 (Atp6v0e)
  09156 Nervous system
   04721 Synaptic vesicle cycle
    11974 (Atp6v0e)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    11974 (Atp6v0e)
  09163 Immune disease
   05323 Rheumatoid arthritis
    11974 (Atp6v0e)
SSDB
Motif
Pfam: ATP_synt_H
Other DBs
NCBI-GeneID: 11974
NCBI-ProteinID: NP_079548
MGI: 1328318
Ensembl: ENSMUSG00000015575
UniProt: Q9CQD8
Position
17:26895370..26918621
AA seq 81 aa
MAYHGLTVPLIVMSVFWGFVGLLVPWFIPKGPNRGVIITMLVTCSVCCYLFWLIAILAQL
NPLFGPQLKNETIWYLKYHWP
NT seq 246 nt   +upstreamnt  +downstreamnt
atggcataccacggccttactgtgcctttgatcgtgatgagcgtgttctggggcttcgtg
ggcctcctcgtgccctggtttatccccaagggtcctaaccggggagttatcatcaccatg
ttggtgacttgttcagtttgctgctatctcttttggctgattgcaattctggcacagctc
aatcctctgtttggaccacagttgaaaaatgaaaccatctggtatctgaagtaccactgg
ccttga

KEGG   Mus musculus (house mouse): 11975
Entry
11975             CDS       T01002                                 
Symbol
Atp6v0a1, AA959968, ATP6a1, Atp6n1, Atp6n1a, Atpv0a1, Vpp-1, Vpp1
Name
(RefSeq) ATPase, H+ transporting, lysosomal V0 subunit A1
  KO
K02154  V-type H+-transporting ATPase subunit a
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu00190  Oxidative phosphorylation
mmu01100  Metabolic pathways
mmu04142  Lysosome
mmu04145  Phagosome
mmu04721  Synaptic vesicle cycle
mmu04966  Collecting duct acid secretion
mmu05152  Tuberculosis
mmu05165  Human papillomavirus infection
mmu05323  Rheumatoid arthritis
Module
mmu_M00160  V-type ATPase, eukaryotes
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    11975 (Atp6v0a1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    11975 (Atp6v0a1)
   04142 Lysosome
    11975 (Atp6v0a1)
 09150 Organismal Systems
  09155 Excretory system
   04966 Collecting duct acid secretion
    11975 (Atp6v0a1)
  09156 Nervous system
   04721 Synaptic vesicle cycle
    11975 (Atp6v0a1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    11975 (Atp6v0a1)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    11975 (Atp6v0a1)
  09163 Immune disease
   05323 Rheumatoid arthritis
    11975 (Atp6v0a1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    11975 (Atp6v0a1)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   11975 (Atp6v0a1)
SSDB
Motif
Pfam: V_ATPase_I
Other DBs
NCBI-GeneID: 11975
NCBI-ProteinID: NP_001229980
MGI: 103286
Ensembl: ENSMUSG00000019302
Vega: OTTMUSG00000002124
UniProt: Q9Z1G4 Q3TY98 Q3TXT5
Position
11:100899262..100954545
AA seq 839 aa
MGELFRSEEMTLAQLFLQSEAAYCCVSELGELGKVQFRDLNPDVNVFQRKFVNEVRRCEE
MDRKLRFVEKEIRKANIPIMDTGENPEVPFPRDMIDLEANFEKIENELKEINTNQEALKR
NFLELTELKFILRKTQQFFDEAELHHQQMADPDLLEESSSLLEPNEMGRGAPLRLGFVAG
VINRERIPTFERMLWRVCRGNVFLRQAEIENPLEDPVTGDYVHKSVFIIFFQGDQLKNRV
KKICEGFRASLYPCPETPQERKEMASGVNTRIDDLQMVLNQTEDHRQRVLQAAAKNIRVW
FIKVRKMKAIYHTLNLCNIDVTQKCLIAEVWCPVTDLDSIQFALRRGTEHSGSTVPSILN
RMQTNQTPPTYNKTNKFTHGFQNIVDAYGIGTYREINPAPYTVITFPFLFAVMFGDFGHG
ILMTLFAVWMVLRESRILSQKHENEMFSMVFSGRYIILLMGLFSIYTGLIYNDCFSKSLN
IFGSSWSVRPMFTQGNWTEETLLGSSVLQLNPAIPGVFGGPYPFGIDPIWNIATNKLTFL
NSFKMKMSVILGIIHMLFGVSLSLFNHIYFKKPLNIYFGFIPEIIFMSSLFGYLVILIFY
KWTAYDAHSSRNAPSLLIHFINMFLFSYPESGNAMLYSGQKGIQCFLIVVAMLCVPWMLL
FKPLILRHQYLRKKHLGTLNFGGIRVGNGPTEEDAEIIQHDQLSTHSEDAEEFDFGDTMV
HQAIHTIEYCLGCISNTASYLRLWALSLAHAQLSEVLWTMVIHIGLHVRSLAGGLGLFFI
FAAFATLTVAILLIMEGLSAFLHALRLHWVEFQNKFYTGTGFKFLPFSFEHIREGKFDE
NT seq 2520 nt   +upstreamnt  +downstreamnt
atgggggagcttttccggagtgaggagatgacgctggcccagctatttctacagtctgaa
gctgcttattgctgtgtcagtgaattaggagagcttgggaaggtccaatttcgggattta
aatccagatgtgaatgttttccagaggaaatttgtgaatgaagttagaagatgtgaagaa
atggatcgaaaactccgatttgttgagaaagagataaggaaagctaacatcccaattatg
gacaccggtgaaaacccagaggtgcccttccctcgggacatgatcgacttagaggccaat
ttcgagaagattgaaaatgaactgaaggaaatcaacactaaccaggaagctctgaagaga
aacttcctggaactgactgaattaaaatttatcctgcgaaaaacccagcagtttttcgat
gaggctgaattgcatcatcagcagatggcggatccagacctgttggaagagtcctcatca
ctcttggagccaaacgagatgggaagaggcgcacccttacgacttggctttgtggctggt
gtgattaaccgggagcggatcccgacctttgagcgcatgctttggcgagtgtgccgaggg
aatgtgttcctgagacaagctgaaatcgaaaacccgctggaggatcctgtgactggcgac
tacgtgcacaagtctgtgttcatcatttttttccaaggcgatcagctgaaaaacagggtc
aagaaaatctgtgaagggttccgagcctccctctatccctgccctgagactccacaggaa
aggaaagaaatggcttccggagtcaataccaggatcgacgacctccaaatggttctgaat
cagacggaggaccaccgccagagggttctgcaggcagctgctaagaacatccgcgtctgg
ttcatcaaggtgcggaagatgaaggctatctaccataccctgaacctgtgcaatatagac
gtgacccagaagtgcctgatcgcagaagtctggtgccctgtcactgacctggactccatc
cagtttgcactacgaagaggcacggaacacagtgggtccactgtcccctccattctgaac
aggatgcagacaaaccagacaccgccgacatataataaaaccaacaagttcacgcacggc
ttccagaacatagtagatgcttatgggatcggcacttaccgagagattaacccagctccg
tacactgtcatcaccttcccctttctgtttgctgtgatgttcggagattttgggcacggc
attttgatgacgctgtttgctgtgtggatggtgttgagggagagccggatcctctcccag
aagcacgagaatgagatgtttagcatggtgttcagcggccggtacattattcttctgatg
ggactgttctccatctatactggactcatctacaatgactgcttttccaagtctctgaat
atctttgggtcatcgtggagtgtacggccaatgttcactcaagggaactggacggaggag
acgcttctggggagttctgttctccagttgaaccccgctatccctggagtttttggtggc
ccgtacccgtttggcattgatccgatttggaacattgcaaccaacaagctgaccttcctc
aactccttcaagatgaagatgtctgttatcctcggcatcatccacatgctgtttggagtc
agcctgagccttttcaaccatatctatttcaagaagcccctgaacatctactttggcttt
attcctgagatcatcttcatgtcctcgttgtttggctacctggtcatccttatcttttac
aagtggacagcctacgatgcccactcgtctaggaatgccccgagcctcctgatccacttc
ataaacatgttcctcttctcctacccagagtctggtaatgcaatgctgtactctggacag
aaaggaattcagtgtttcctcatcgtggtggcgatgctctgcgtcccttggatgcttctg
tttaagccgctgatccttcgccatcagtacctgaggaagaagcatttgggaactctcaac
tttggtgggatcagggtgggcaacggaccgacagaggaggatgctgaaattattcagcat
gaccagctttccacccattcagaggacgcagaagagtttgactttggcgacaccatggtc
caccaggccatccacaccattgagtactgcttgggttgtatctccaacaccgcgtcgtac
ctgcgactctgggccctcagcctggcccacgcacagctctctgaagtactttggaccatg
gtgatccacattggcctgcacgtccggagtttggccgggggtctagggctgtttttcatc
ttcgccgcctttgccacgctgaccgtggctatcctgctgatcatggagggcctctcggcc
ttcctccacgcgctgcggttacactgggtggagttccagaacaaattctacactgggact
ggcttcaagttcctccccttctcctttgagcacattcgggaagggaagtttgatgagtga

KEGG   Mus musculus (house mouse): 11984
Entry
11984             CDS       T01002                                 
Symbol
Atp6v0c, Atp6c, Atp6c2, Atp6l, Atpl, Atpl-rs1, PL16, VATL, Vma3
Name
(RefSeq) ATPase, H+ transporting, lysosomal V0 subunit C
  KO
K02155  V-type H+-transporting ATPase 16kDa proteolipid subunit
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu00190  Oxidative phosphorylation
mmu01100  Metabolic pathways
mmu04142  Lysosome
mmu04145  Phagosome
mmu04721  Synaptic vesicle cycle
mmu04966  Collecting duct acid secretion
mmu05152  Tuberculosis
mmu05165  Human papillomavirus infection
mmu05323  Rheumatoid arthritis
Module
mmu_M00160  V-type ATPase, eukaryotes
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    11984 (Atp6v0c)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    11984 (Atp6v0c)
   04142 Lysosome
    11984 (Atp6v0c)
 09150 Organismal Systems
  09155 Excretory system
   04966 Collecting duct acid secretion
    11984 (Atp6v0c)
  09156 Nervous system
   04721 Synaptic vesicle cycle
    11984 (Atp6v0c)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    11984 (Atp6v0c)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    11984 (Atp6v0c)
  09163 Immune disease
   05323 Rheumatoid arthritis
    11984 (Atp6v0c)
SSDB
Motif
Pfam: ATP-synt_C
Other DBs
NCBI-GeneID: 11984
NCBI-ProteinID: NP_033859
MGI: 88116
Ensembl: ENSMUSG00000024121
Vega: OTTMUSG00000023843
UniProt: P63082 A3KML5
Position
17:complement(24382839..24388652)
AA seq 155 aa
MADIKNNPEYSSFFGVMGASSAMVFSAMGAAYGTAKSGTGIAAMSVMRPELIMKSIIPVV
MAGIIAIYGLVVAVLIANSLTDGITLYRSFLQLGAGLSVGLSGLAAGFAIGIVGDAGVRG
TAQQPRLFVGMILILIFAEVLGLYGLIVALILSTK
NT seq 468 nt   +upstreamnt  +downstreamnt
atggctgacatcaagaacaaccccgaatattcttcgtttttcggtgtcatgggcgcctcg
tccgccatggtcttcagcgccatgggagccgcctatggcacagccaagagtggcactggc
atcgcagccatgtcagtcatgaggccagagctgatcatgaagtccatcatcccagtggtt
atggctgggatcatcgccatctacggcctggtggtggcagtacttatcgctaactccctg
actgatggcatcaccctctacaggagttttcttcaactgggtgctggcctgagtgtgggg
ctgagtggcctggctgctggctttgccattggcatcgtcggagatgctggtgttcggggc
actgcccagcagcctcgactgttcgtgggcatgatcctgatcctcatctttgcggaggtg
cttggcctctacggtctcatcgtggccctaatcctctccacaaagtag

KEGG   Mus musculus (house mouse): 140494
Entry
140494            CDS       T01002                                 
Symbol
Atp6v0a4, Atp6n1b, a4
Name
(RefSeq) ATPase, H+ transporting, lysosomal V0 subunit A4
  KO
K02154  V-type H+-transporting ATPase subunit a
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu00190  Oxidative phosphorylation
mmu01100  Metabolic pathways
mmu04142  Lysosome
mmu04145  Phagosome
mmu04721  Synaptic vesicle cycle
mmu04966  Collecting duct acid secretion
mmu05152  Tuberculosis
mmu05165  Human papillomavirus infection
mmu05323  Rheumatoid arthritis
Module
mmu_M00160  V-type ATPase, eukaryotes
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    140494 (Atp6v0a4)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    140494 (Atp6v0a4)
   04142 Lysosome
    140494 (Atp6v0a4)
 09150 Organismal Systems
  09155 Excretory system
   04966 Collecting duct acid secretion
    140494 (Atp6v0a4)
  09156 Nervous system
   04721 Synaptic vesicle cycle
    140494 (Atp6v0a4)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    140494 (Atp6v0a4)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    140494 (Atp6v0a4)
  09163 Immune disease
   05323 Rheumatoid arthritis
    140494 (Atp6v0a4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    140494 (Atp6v0a4)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   140494 (Atp6v0a4)
SSDB
Motif
Pfam: V_ATPase_I IFP_35_N Cyclin_N2
Other DBs
NCBI-GeneID: 140494
NCBI-ProteinID: NP_536715
MGI: 2153480
Ensembl: ENSMUSG00000038600
Vega: OTTMUSG00000022440
UniProt: Q920R6 Q3UP55
Position
6:complement(38025418..38101521)
AA seq 833 aa
MASVFRSEEMCLSQVFLQVEAAYCCVAELGELGLVQFKDLNANVNSFQRKFVNEVRRCES
LERILRFLEDEMQNEILIQVPEKDAETPLPREMITLETTLEKLEGELQEANQSHQALKKS
FLELTELKYLLKKTQDFFETETNLGEDFFVEDTSGLLELRTIPAFMTGKLGFTAGVINRE
RMASFERLLWRVCRGNVYLKFSEMDTLLEDPVTKEEIKKNIFIIFYQGEQLRLKIKKICD
GFRATIYPCPEHAAERREMLTSVNVRLEDLITVITQTESHRQRLLQEAAANWHSWVIKVQ
KMKAVYHVLNMCNIDVTQQCIIAEIWFPVADTRHIKKALEQGMELSGSSMIPIMTEVETK
TDPPTFNRTNKFTAGFQNIVDAYGVGSYREINPAPYTIITFPFLFAVMFGDCGHGMVMLM
AALWMVLNERHLLAQKSTNEMWNIFFNGRYLILLMGIFSIYTGLIYNDCFSKSFNIFGSS
WSVQPMFRNGTWNTHIVENSPYLQLDPAIPGVYSGNPYPFGIDPIWNLASNKLTFLNSYK
MKMSVILGIAHMIFGVILSLFNHIYFRRTLNIILQFIPEMIFMLSLFGYLVFMIIFKWCR
YDAHTSRKAPSILIHFIGMFLFDYDDSSNAPLYGHQQEVQTFFVIIALVSVPWMLLIKPF
VLRAKHQKSQLQSFTIHEDAVEGDHSGHSSKKTAGAHGMKDGHEEEFNFGDIFVHQAIHT
IEYCLGCISNTASYLRLWALSLAHAELSEVLWTMVMSIGLRLQGWAGLVGVFIIFAVFAV
LTVAILLVMEGLSAFLHALRLHWVEFQNKFYEGAGSKFSPFSFKHVLEGTAEE
NT seq 2502 nt   +upstreamnt  +downstreamnt
atggcatctgtgtttcgaagtgaggagatgtgtttatcccaagtgtttctccaggtggag
gctgcgtattgctgtgtagctgagctgggagagcttggcttggttcagttcaaagatcta
aatgcaaatgtgaacagcttccagaggaagtttgtgaatgaagtccgaaggtgtgagtca
ctggagagaatcctgcgttttctggaagatgagatgcaaaacgagattttaatccaagtg
cctgagaaggatgctgagacccctctccctcgggaaatgatcaccctggagacgactcta
gagaagttggaaggagagctgcaggaagccaaccagagccaccaggctttgaagaagagc
tttctggaactgacagagctcaaatacctcctaaagaaaacccaggacttttttgagaca
gaaaccaacttaggtgaagatttctttgttgaagacacttcgggtctcttggagctaaga
accatacctgccttcatgactggaaagttggggttcacggctggtgtgataaacagggag
aggatggcttccttcgagaggctgctgtggagagtttgccggggaaacgtgtacttgaag
ttcagtgaaatggacacacttctggaggaccctgtgacgaaagaagaaattaaaaagaat
atattcatcatattttaccaaggagaacagctcaggctgaaaatcaagaagatctgtgac
gggtttcgtgctaccatctacccctgcccagagcatgcagcagagcgcagagagatgctg
accagtgtcaacgtgaggctggaagacttaatcaccgtcattacccaaacagagtctcac
cgacagcgcctgctgcaggaagcagctgccaactggcactcctgggtcatcaaagtacag
aagatgaaggccgtctaccatgtgctgaacatgtgcaacattgacgtcacccagcagtgc
atcattgccgagatctggttcccagtagcagacactagacacattaagaaggccctggag
caaggcatggaactcagtggctcctccatgattcccatcatgacagaagtggaaactaaa
acagaccctcccaccttcaacaggacgaataaatttacagctggcttccagaacattgtt
gatgcgtatggtgtaggtagctaccgagagataaacccagctccctacactatcatcacc
ttccccttcctgttcgctgtgatgtttggagactgtggtcatggaatggtgatgctgatg
gcagccttgtggatggtcctaaatgagaggcacttgctggctcagaagagcaccaacgag
atgtggaacatcttcttcaatgggcgctatttgatcctgctcatgggtatcttctccatc
tacaccggcttgatctacaacgactgtttctccaaatcttttaacatctttggctcctct
tggagtgtccagcctatgttcagaaacggcacgtggaatactcacatcgtggaaaacagt
ccatatttgcagctggacccagccatcccaggagtgtattctgggaatccctacccattt
ggaattgatccgatttggaacctggcttcaaacaagcttacatttttaaactcctataag
atgaagatgtcagtcatcctgggaatcgctcatatgatttttggtgttattctcagcctc
ttcaatcacatttacttcagaagaaccctcaacatcattctgcaattcattcccgagatg
atttttatgctgagtctgtttggatacctggttttcatgatcattttcaagtggtgccga
tatgatgcccacacatcccggaaggctcctagcatcctcatccactttatcggcatgttt
ctgttcgactacgatgactcttccaacgcacccctgtatggacatcagcaagaagtccag
actttctttgtcatcatagcgctggtgtctgtgccatggatgcttttgattaagccattt
gttcttagagccaagcaccagaaatctcagctgcagtctttcacgatccacgaggatgct
gtggagggtgaccactcgggccactcttctaagaagactgcaggtgcccatgggatgaag
gacggccatgaggaggagttcaactttggagacatctttgtccaccaagccattcacacc
attgagtactgcctaggctgcatctctaatacagcctcgtaccttcggctctgggccctc
agcttggctcacgctgagctgtccgaggtgctctggaccatggtcatgagcatcggcctt
cgccttcaaggctgggcagggctcgttggtgtcttcatcatttttgcggtcttcgccgtc
ctcaccgtggccatcctccttgtcatggagggtctctcagcctttctgcacgccctccgg
ctgcattgggtggaattccagaacaagttctatgagggggctggctccaagttctccccc
ttctcctttaagcacgtcctggaaggcacagctgaggagtag

KEGG   Mus musculus (house mouse): 21871
Entry
21871             CDS       T01002                                 
Symbol
Atp6v0a2, 8430408C20Rik, AI385560, ATP6a2, AW489264, Atp6n1d, Atp6n2, C76904, ISF, J6B7, SHIF, Stv1, TJ6M, TJ6s, Tj6, V-ATPase_116_kDa, V-ATPase_a2
Name
(RefSeq) ATPase, H+ transporting, lysosomal V0 subunit A2
  KO
K02154  V-type H+-transporting ATPase subunit a
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu00190  Oxidative phosphorylation
mmu01100  Metabolic pathways
mmu04142  Lysosome
mmu04145  Phagosome
mmu04721  Synaptic vesicle cycle
mmu04966  Collecting duct acid secretion
mmu05152  Tuberculosis
mmu05165  Human papillomavirus infection
mmu05323  Rheumatoid arthritis
Module
mmu_M00160  V-type ATPase, eukaryotes
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    21871 (Atp6v0a2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    21871 (Atp6v0a2)
   04142 Lysosome
    21871 (Atp6v0a2)
 09150 Organismal Systems
  09155 Excretory system
   04966 Collecting duct acid secretion
    21871 (Atp6v0a2)
  09156 Nervous system
   04721 Synaptic vesicle cycle
    21871 (Atp6v0a2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    21871 (Atp6v0a2)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    21871 (Atp6v0a2)
  09163 Immune disease
   05323 Rheumatoid arthritis
    21871 (Atp6v0a2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    21871 (Atp6v0a2)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   21871 (Atp6v0a2)
SSDB
Motif
Pfam: V_ATPase_I Takusan
Other DBs
NCBI-GeneID: 21871
NCBI-ProteinID: NP_035726
MGI: 104855
Ensembl: ENSMUSG00000038023
Vega: OTTMUSG00000054960
UniProt: P15920
Structure
Position
5:124767117..124801519
AA seq 856 aa
MGSLFRSESMCLAQLFLQSGTAYECLSALGEKGLVQFRDLNQNVSSFQRKFVGEVKRCEE
LERILVYLVQEITRADIPLPEGEASPPAPPLKHVLEMQEQLQKLEVELREVTKNKEKLRK
NLLELVEYTHMLRVTKTFLKRNVEFEPTYEEFPALENDSLLDYSCMQRLGAKLGFVSGLI
QQGRVEAFERMLWRACKGYTIVTYAELDECLEDPETGEVIKWYVFLISFWGEQIGHKVKK
ICDCYHCHIYPYPNTAEERREIQEGLNTRIQDLYTVLHKTEDYLRQVLCKAAESVCSRVV
QVRKMKAIYHMLNMCSFDVTNKCLIAEVWCPEVDLPGLRRALEEGSRESGATIPSFMNTI
PTKETPPTLIRTNKFTEGFQNIVDAYGVGSYREVNPALFTIITFPFLFAVMFGDFGHGFV
MFLFALLLVLNENHPRLSQSQEILRMFFDGRYILLLMGLFSVYTGLIYNDCFSKSVNLFG
SGWNVSAMYSSSHSPEEQRKMVLWNDSTIRHSRTLQLDPNIPGVFRGPYPFGIDPIWNLA
TNRLTFLNSFKMKMSVILGIFHMTFGVVLGIFNHLHFRKKFNVYLVSVPEILFMLCIFGY
LIFMIIYKWLAYSAETSREAPSILIEFINMFLFPTSKTHGLYPGQAHVQRVLVALTVLAV
PVLFLGKPLFLLWLHNGRNCFGMSRSGYTLVRKDSEEEVSLLGNQDIEEGNSRMEEGCRE
VTCEEFNFGEILMTQAIHSIEYCLGCISNTASYLRLWALSLAHAQLSDVLWAMLMRVGLR
VDTTYGVLLLLPVMAFFAVLTIFILLVMEGLSAFLHAIRLHWVEFQNKFYVGAGTKFVPF
SFSLLSSKFSNDDSIA
NT seq 2571 nt   +upstreamnt  +downstreamnt
atgggctctctcttccgcagcgagagcatgtgcctggcgcagctcttcctgcagtcgggc
acggcctacgagtgtctgagcgcgctgggcgagaagggcctggtgcagttccgagacctc
aatcaaaatgtaagttcttttcaaagaaaattcgtcggtgaggtaaagaggtgtgaagag
ctcgaacgaatactggtgtacctggtgcaggaaatcaccagagctgatattcccctgcct
gaaggagaggccagtcctcccgcaccacctcttaaacatgtcctagaaatgcaggaacag
ctgcagaagctggaggtggagctcagagaagtcaccaagaacaaggagaagctgaggaag
aacctgttggagctggtggagtacacccacatgctgagggtcacgaagaccttcctcaag
cggaatgtggagtttgagcccacgtatgaagagtttcccgccttagagaacgactctctg
ttggactacagctgcatgcagcggctgggcgccaagctgggattcgtttctggcctgatt
cagcaaggcagagttgaagcatttgaaaggatgctgtggcgggcctgcaaagggtacacc
attgtgacctatgcagagctggacgagtgcctggaggaccctgaaacgggtgaagtcata
aagtggtacgtgttcctgatttccttttggggagagcagattggccacaaggttaagaag
atatgtgactgttaccactgccacatctacccgtatccaaacacggctgaggagcgcagg
gagattcaggaggggctcaatactcggatccaagacctttacacggtgctgcacaaaacg
gaggactatctgcggcaagtgctctgcaaagctgccgagtccgtgtgcagccgtgtggtc
caggtgaggaagatgaaggccatctaccacatgctcaacatgtgcagctttgacgtcacc
aacaagtgcctcatagctgaggtctggtgccccgaggtggacctgccaggcttgcgcaga
gcactggaggaaggctcgagagagagcggagctacaatcccctcgttcatgaacacaatc
cctacgaaagaaacaccccccactctgatccgcaccaacaaattcactgaaggtttccag
aacatcgtggatgcctatggagtcgggagctacagagaagtgaacccagctctctttacc
atcatcaccttcccgttcctgtttgctgtgatgtttggcgactttgggcacggctttgtc
atgttcctgtttgccctcttactggtgttaaatgagaatcaccccagactaagccagtca
caggagatccttaggatgttctttgacggccggtatatcctgctgctgatggggctgttc
tctgtgtacaccggcctcatctacaacgactgcttctccaagtctgtgaacctctttggt
tctgggtggaacgtatctgccatgtacagctccagccactctccagaggagcagaggaag
atggtactttggaatgacagcaccatcaggcacagcaggactttgcagctggacccgaat
atccctggagttttccgaggcccctacccttttggcattgatcctatttggaacctggcc
acaaaccgcctcacgttcctcaactccttcaagatgaaaatgtctgtgattttaggaatt
tttcacatgacttttggtgttgttctgggaatatttaaccacttgcactttaggaagaag
ttcaacgtctacctggtctcggtgcctgagatcctgttcatgctctgcatctttgggtac
ctgattttcatgatcatttacaagtggctggcatactcggcagagacctcgagagaggcc
ccgagcatcctgatcgagttcattaacatgttcctgttcccaaccagcaagacacacggg
ctctacccagggcaggcacacgtccagagagtgttggtggctctcacggtgctggctgtc
cccgtgctcttcttaggaaagccgctttttctgctgtggctgcacaacgggcgcaattgc
tttggcatgagccggagcggttacacactcgtgaggaaggacagcgaggaagaggtgtct
cttctgggcaaccaggacatagaagagggcaacagccgcatggaagaaggctgccgagaa
gtgacgtgtgaggagtttaacttcggggagatcctgatgacgcaggccatccactccatt
gagtactgcctcggctgcatctccaacaccgcctcctacctgaggctctgggcactcagc
ctggcccatgcacagctctctgatgtgctgtgggccatgctgatgcgcgtggggctgcgt
gtggacaccacctatggggtcttgctgctgctgcctgtcatggctttctttgcagttttg
accatttttatccttctggtcatggagggtctttctgcattcctccacgccataaggctt
cactgggtagaatttcagaacaaattctacgttggtgcaggcaccaagtttgttcccttc
tccttcagtctgctctcctccaagttcagtaatgatgacagcatagcatga

KEGG   Mus musculus (house mouse): 242341
Entry
242341            CDS       T01002                                 
Symbol
Atp6v0d2, 1620401A02Rik, AI324824, V-ATPase
Name
(RefSeq) ATPase, H+ transporting, lysosomal V0 subunit D2
  KO
K02146  V-type H+-transporting ATPase subunit d
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu00190  Oxidative phosphorylation
mmu01100  Metabolic pathways
mmu04142  Lysosome
mmu04145  Phagosome
mmu04721  Synaptic vesicle cycle
mmu04966  Collecting duct acid secretion
mmu05152  Tuberculosis
mmu05165  Human papillomavirus infection
mmu05203  Viral carcinogenesis
mmu05323  Rheumatoid arthritis
Module
mmu_M00160  V-type ATPase, eukaryotes
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    242341 (Atp6v0d2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    242341 (Atp6v0d2)
   04142 Lysosome
    242341 (Atp6v0d2)
 09150 Organismal Systems
  09155 Excretory system
   04966 Collecting duct acid secretion
    242341 (Atp6v0d2)
  09156 Nervous system
   04721 Synaptic vesicle cycle
    242341 (Atp6v0d2)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    242341 (Atp6v0d2)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    242341 (Atp6v0d2)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    242341 (Atp6v0d2)
  09163 Immune disease
   05323 Rheumatoid arthritis
    242341 (Atp6v0d2)
SSDB
Motif
Pfam: vATP-synt_AC39 TLP1_add_C
Other DBs
NCBI-GeneID: 242341
NCBI-ProteinID: NP_780615
MGI: 1924415
Ensembl: ENSMUSG00000028238
Vega: OTTMUSG00000006382
UniProt: Q80SY3
Position
4:complement(19876838..19922566)
AA seq 350 aa
MLETAELYFNVDHGYLEGLVRGCKASLLTQQDYVNLVQCETLEDLKIHLQTTDYGNFLAN
ETNPLTVSKIDTEMRKKLCREFDYFRNHSLEPLSTFLTYMTCSYMIDNIILLMNGALQKK
SVKEVLAKCHPLGRFTEMEAVNIAETPSDLFKAVLVETPLAPFFQDCMSENTLDELNIEL
LRNKLYKSYLEAFYKFCKDHGDVTADVMCPILEFEADRRALIITLNSFGTELSKEDRETL
FPTCGRLYPEGLRLLAQAEDFEQMKRVADNYGVYKPLFDAVGGSGGKTLEDVFYEREVQM
NVLAFNRQFHYGVFYAYVKLKEQEMRNIVWIAECISQRHRTKINSYIPIL
NT seq 1053 nt   +upstreamnt  +downstreamnt
atgcttgagactgcagagctgtacttcaatgtggaccatggctacctggagggcctggtt
cgaggatgcaaagccagcctcctaactcagcaggactatgtcaacctagtgcagtgtgag
accttggaagacctgaaaattcatctccagaccacggactatggcaacttcctggctaat
gaaacaaatcctctcactgtttccaaaattgacacggagatgaggaagaagctctgcaga
gagtttgactatttccggaatcattccttggagcccctgagcacatttctcacctacatg
acatgcagctatatgatagacaatataattctacttatgaatggggccttgcaaaagaaa
tctgtgaaagaagttctagccaagtgtcacccactgggccgtttcacagagatggaagct
gtcaacattgcagagaccccctcagatctcttcaaggctgtgctggttgaaacaccatta
gctccattctttcaagattgtatgtctgaaaacactcttgatgaactgaatattgaatta
ctgcgcaataaactatacaagtcttaccttgaggcattctacaaattctgcaaggatcac
ggtgatgtcacagcagacgttatgtgtcccattcttgagtttgaggccgacagacgcgct
ttaatcatcactctgaactcatttggcactgaactaagcaaagaagacagggagaccctc
ttccccacctgcggcaggctctatccagaggggttgcggttgttagctcaagctgaagac
tttgagcagatgaagagagtggcagataattatggagtttacaagcctttgtttgacgct
gtcggtggcagtggggggaagacactggaagacgttttctatgagagagaggtacagatg
aatgtgctggcattcaacaggcaattccattatggtgtgttttatgcgtatgtaaagttg
aaggagcaagagatgagaaatatcgtgtggatagcagaatgcatctcacagaggcatcga
actaaaatcaacagctacattccaattttataa

KEGG   Mus musculus (house mouse): 27060
Entry
27060             CDS       T01002                                 
Symbol
Tcirg1, ATP6N1C, ATP6a3, Atp6i, OC-116, OPTB1, Stv1, TIRC7, Vph1, oc
Name
(RefSeq) T cell, immune regulator 1, ATPase, H+ transporting, lysosomal V0 protein A3
  KO
K02154  V-type H+-transporting ATPase subunit a
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu00190  Oxidative phosphorylation
mmu01100  Metabolic pathways
mmu04142  Lysosome
mmu04145  Phagosome
mmu04721  Synaptic vesicle cycle
mmu04966  Collecting duct acid secretion
mmu05152  Tuberculosis
mmu05165  Human papillomavirus infection
mmu05323  Rheumatoid arthritis
Module
mmu_M00160  V-type ATPase, eukaryotes
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    27060 (Tcirg1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    27060 (Tcirg1)
   04142 Lysosome
    27060 (Tcirg1)
 09150 Organismal Systems
  09155 Excretory system
   04966 Collecting duct acid secretion
    27060 (Tcirg1)
  09156 Nervous system
   04721 Synaptic vesicle cycle
    27060 (Tcirg1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    27060 (Tcirg1)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    27060 (Tcirg1)
  09163 Immune disease
   05323 Rheumatoid arthritis
    27060 (Tcirg1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    27060 (Tcirg1)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   27060 (Tcirg1)
SSDB
Motif
Pfam: V_ATPase_I APG6_N DUF2730
Other DBs
NCBI-GeneID: 27060
NCBI-ProteinID: NP_001129563
MGI: 1350931
Ensembl: ENSMUSG00000001750
Vega: OTTMUSG00000033070
UniProt: Q9JHF5
Position
19:complement(3946050..3957717)
AA seq 834 aa
MGSMFRSEEVALVQLLLPTGSAYNCVSQLGELGLVEFRDLNESVSAFQRRFVVDVRRCEE
LEKTFTFLREEVQRAGLTLAPPEGTLPAPPPRDLLRIQEETDRLAQELRDVRGNQQALRA
QLHQLRLHSAVLGQSHSPPVAADHTEGPFSETTPLLPGTRGPHSDLKVNFVAGAVEPYKA
AALERLLWRACRGFLIASFRETEGQLEDPVTGEPATWMTFVISYWGEQIGQKIRKITDCF
HCHVFPYLEQEEARFRTLQQLQQQSQELQEVLGETDRFLSQVLGRVQQLLPPWQVQIHKM
KAVYLTLNQCSVNTTHKCLIAEVWCAARDLPTVQQALQSGSSEEGVSAVAHRIPCQDMPP
TLIRTNRFTSSFQGIVDAYGVGRYREVNPAPYTIITFPFLFAVMFGDVGHGLLMFLFALA
MVLTENRPAVKAAQNEIWQTFFGGRYLLLLMGLFSVYTGFIYNECFSRATTIFPSGWSVA
AMANQSGWSDEYLSQHSMLTLNPNITGVFLGPYPFGIDPIWSLATNHLSFLNSFKMKMSV
ILGVTHMAFGVFLSIFNHVHFGQAHRLLLETLPELIFLLGLFGYLVFLIVYKWVNVSAAS
ASSAPSILIHFINMFLFSQNPTNHLLFHGQEVVQYVLVVLALATVPILLLGTPLYLLRQH
RHRRNTQRRPAGQQDEDTDKLLASPDASTLENSWSPDEEKAGSPGDEETEFVPSEIFMHQ
AIHTIEFCLGCISNTASYLRLWALSLAHAQLSEVLWAMVMRIGLGMGREIGVAAVVLVPV
FAAFAVLTVAILLVMEGLSAFLHALRLHWVEFQNKFYSGTGYKLSPFTFTVDSD
NT seq 2505 nt   +upstreamnt  +downstreamnt
atgggctctatgttccggagtgaagaggtggccttggtccagctcctgttgcccacaggg
tctgcttacaactgtgtgagccagcttggtgagctgggcctcgtggagttcagagacctc
aacgaatccgtgagcgccttccagagacgcttcgtggtagacgtccggcgctgcgaggaa
ctggagaagacgtttaccttcttgcgggaagaagtgcagcgggcaggtctgacgctggcc
ccacctgaggggacactgccagcaccacctccccgagacctgctgcgcatccaggaggaa
acggatcgcttggcccaggagcttcgggatgttcgtggcaatcagcaggcactgcgggcc
cagctgcaccagctgcggcttcactcggctgtgctgggccagagccacagcccgccggtg
gcagctgaccatactgaaggacccttctctgagacaacacccctgcttccaggcacccgg
gggccacattcagacctgaaggtcaattttgtggcaggtgctgtggagccctacaaggct
gcggccctggagcgcctgctgtggagagcttgccgcggcttcctcattgccagctttcgg
gagactgaggggcagctggaggacccagtgacgggtgagcctgcaacttggatgaccttt
gtcatctcctactggggtgagcagatcggacagaagatccgaaagatcacagactgcttc
cactgtcatgtcttcccatacctggagcaggaggaagcccggttcaggaccttgcagcag
ctgcagcagcaaagccaggagcttcaggaagtcctgggggagacagaccggttcctgagc
caggtgttgggccgggtgcagcagctgctgcccccatggcaggtgcagatccacaagatg
aaggcagtgtacctgaccctcaaccagtgcagtgtgaacaccacacacaagtgcctcatc
gcggaggtctggtgtgccgcgagggacctgcccactgtgcagcaggcgctgcagagcggc
tcaagtgaggaaggagtgagtgctgtcgctcaccgcatcccctgccaggacatgcctcca
accctcatcaggaccaaccgcttcacctccagcttccagggcattgtggatgcctatggt
gtgggccgctacagggaagttaaccctgctccctacaccatcatcacattcccctttctc
ttcgctgtgatgtttggcgatgtggggcacggactgctcatgtttctctttgccctggcc
atggtcctcactgaaaaccgtccagctgtgaaggctgcacaaaacgagatctggcagacc
ttctttgggggtcgatacctactcctgctcatgggtctgttctccgtctacactggcttc
atctacaatgagtgcttcagccgagccaccactattttcccctcaggttggagtgtggct
gccatggccaaccagtcaggctggagtgacgagtatctgtcccagcactccatgctcacc
ctgaaccctaacatcactggtgtcttccttggaccatatccctttggcattgacccgatc
tggagcctggccacgaaccacctgagctttctcaactccttcaagatgaagatgtctgtc
atccttggggtcacgcacatggcctttggggtgttcctcagcatcttcaaccacgtgcac
tttggccaggcccaccggctactgctggagaccttgcctgagctcatcttcctgctgggt
ctctttggctaccttgtgttcctcattgtctacaagtgggtgaatgtctcagctgctagc
gcctcctcggcccccagtatcctcattcacttcatcaatatgttcctcttctctcaaaac
cccaccaatcatctgctcttccatgggcaggaagtggtacagtacgtgctggtggtcctg
gctttggctaccgttcctatcctgttgctgggcacacccttgtacctgctgcgccagcac
cgccacagaagaaacactcagagaaggccagcaggccagcaggatgaggacacggacaag
cttctggcctcccctgatgcatccaccttggagaacagctggagccctgatgaggagaag
gctgggagcccaggggatgaagaaactgagtttgtcccttctgagatcttcatgcaccaa
gcaatccacaccattgagttctgcctgggctgcatctccaacacagcctcctacttgcgt
ctctgggccctgagcctggcccatgcccagctgtctgaggtcctgtgggccatggtgatg
cgcataggcctgggcatgggccgagagatcggcgtggcagctgtggtgctggtccctgtg
tttgctgcctttgctgtgttgactgtggccatcctgttagtgatggaggggctctcagcc
ttcctgcatgccctgcggttgcactgggtggagttccagaacaagttctattcaggcacc
ggctacaagctcagccccttcaccttcactgtggacagtgactag

KEGG   Mus musculus (house mouse): 338375
Entry
338375            CDS       T01002                                 
Symbol
Atp6v1g3
Name
(RefSeq) ATPase, H+ transporting, lysosomal V1 subunit G3
  KO
K02152  V-type H+-transporting ATPase subunit G
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu00190  Oxidative phosphorylation
mmu01100  Metabolic pathways
mmu04145  Phagosome
mmu04150  mTOR signaling pathway
mmu04721  Synaptic vesicle cycle
mmu04966  Collecting duct acid secretion
mmu05165  Human papillomavirus infection
mmu05323  Rheumatoid arthritis
Module
mmu_M00160  V-type ATPase, eukaryotes
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    338375 (Atp6v1g3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04150 mTOR signaling pathway
    338375 (Atp6v1g3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    338375 (Atp6v1g3)
 09150 Organismal Systems
  09155 Excretory system
   04966 Collecting duct acid secretion
    338375 (Atp6v1g3)
  09156 Nervous system
   04721 Synaptic vesicle cycle
    338375 (Atp6v1g3)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    338375 (Atp6v1g3)
  09163 Immune disease
   05323 Rheumatoid arthritis
    338375 (Atp6v1g3)
SSDB
Motif
Pfam: V-ATPase_G RNase_Y_N Vps5 7TMR-HDED AAA_15 OmpH CemA
Other DBs
NCBI-GeneID: 338375
NCBI-ProteinID: NP_796371
MGI: 2450548
Ensembl: ENSMUSG00000026394
Vega: OTTMUSG00000026869
UniProt: Q8BMC1
Position
1:138201476..138217200
AA seq 118 aa
MTSQSQGIQQLLQAEKRAKDKLDEAKKRKGKRLRQAKEEAVAETDQYRMQMEKDFRLKQA
KIMGSQSHLSDEIEEQTLEKIKELNGSYNKCMESVIKQLLSMVCDMKPEVHVNYRATN
NT seq 357 nt   +upstreamnt  +downstreamnt
atgaccagccagtctcaggggatccaacagctcctgcaggcagagaaaagggccaaggac
aagctagatgaggcaaagaaaagaaaaggaaagcgactgaggcaagctaaggaagaagct
gtggcggagacggaccagtacagaatgcagatggagaaggacttccgcctgaagcaggct
aagataatgggctctcagagccacctctcggatgaaatagaagagcagacactagagaag
atcaaagaattgaacggaagctacaacaagtgtatggaaagcgtgattaagcagctattg
agcatggtgtgcgacatgaaaccagaagtccatgtgaactacagagccaccaactga

KEGG   Mus musculus (house mouse): 66144
Entry
66144             CDS       T01002                                 
Symbol
Atp6v1f, 1110004G16Rik
Name
(RefSeq) ATPase, H+ transporting, lysosomal V1 subunit F
  KO
K02151  V-type H+-transporting ATPase subunit F
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu00190  Oxidative phosphorylation
mmu01100  Metabolic pathways
mmu04145  Phagosome
mmu04150  mTOR signaling pathway
mmu04721  Synaptic vesicle cycle
mmu04966  Collecting duct acid secretion
mmu05165  Human papillomavirus infection
mmu05323  Rheumatoid arthritis
Module
mmu_M00160  V-type ATPase, eukaryotes
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    66144 (Atp6v1f)
 09130 Environmental Information Processing
  09132 Signal transduction
   04150 mTOR signaling pathway
    66144 (Atp6v1f)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    66144 (Atp6v1f)
 09150 Organismal Systems
  09155 Excretory system
   04966 Collecting duct acid secretion
    66144 (Atp6v1f)
  09156 Nervous system
   04721 Synaptic vesicle cycle
    66144 (Atp6v1f)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    66144 (Atp6v1f)
  09163 Immune disease
   05323 Rheumatoid arthritis
    66144 (Atp6v1f)
SSDB
Motif
Pfam: ATP-synt_F
Other DBs
NCBI-GeneID: 66144
NCBI-ProteinID: NP_079657
MGI: 1913394
Ensembl: ENSMUSG00000004285
Vega: OTTMUSG00000023640
UniProt: Q9D1K2
Position
6:29467782..29470508
AA seq 119 aa
MAGRGKLIAVIGDEDTVTGFLLGGIGELNKNRHPNFLVVEKDTTINEIEDTFRQFLNRDD
IGIILINQYIAEMVRHALDAHQRSIPAVLEIPSKEHPYDAAKDSILRRAKGMFTAEDLR
NT seq 360 nt   +upstreamnt  +downstreamnt
atggcgggcagaggtaagctaatcgcggtgattggagacgaggacacggtgactggtttc
ctgttgggcggcataggggagctaaacaagaaccgccaccctaatttcctggtagtggag
aaggataccaccatcaatgagatcgaagacactttcaggcaatttctaaacagggatgac
attggcatcattctcatcaaccagtacatcgcagagatggttcggcacgccctggatgcc
caccagaggtccattccagctgtcctggagatcccgtccaaggagcatccctacgatgca
gccaaagactccatcctgcgcagggccaagggcatgttcaccgctgaagacctgcgctag

KEGG   Mus musculus (house mouse): 66237
Entry
66237             CDS       T01002                                 
Symbol
Atp6v1g2, 1500002D01Rik, Atp6g2, NG38, VAG2
Name
(RefSeq) ATPase, H+ transporting, lysosomal V1 subunit G2
  KO
K02152  V-type H+-transporting ATPase subunit G
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu00190  Oxidative phosphorylation
mmu01100  Metabolic pathways
mmu04145  Phagosome
mmu04150  mTOR signaling pathway
mmu04721  Synaptic vesicle cycle
mmu04966  Collecting duct acid secretion
mmu05165  Human papillomavirus infection
mmu05323  Rheumatoid arthritis
Module
mmu_M00160  V-type ATPase, eukaryotes
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    66237 (Atp6v1g2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04150 mTOR signaling pathway
    66237 (Atp6v1g2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    66237 (Atp6v1g2)
 09150 Organismal Systems
  09155 Excretory system
   04966 Collecting duct acid secretion
    66237 (Atp6v1g2)
  09156 Nervous system
   04721 Synaptic vesicle cycle
    66237 (Atp6v1g2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    66237 (Atp6v1g2)
  09163 Immune disease
   05323 Rheumatoid arthritis
    66237 (Atp6v1g2)
SSDB
Motif
Pfam: V-ATPase_G Zein-binding Josephin
Other DBs
NCBI-GeneID: 66237
NCBI-ProteinID: NP_075668
MGI: 1913487
Ensembl: ENSMUSG00000024403
Vega: OTTMUSG00000031451
UniProt: Q9WTT4 Q54A87
Position
17:35453910..35457743
AA seq 118 aa
MASQTQGIQQLLQAEKRAAEKVADARKRKARRLKQAKEEAQMEVEQYRREREQEFQSKQQ
AAMGSQGNLSAEVEQATRRQVQGMQSSQQRNRERVLAQLLGMVCEVRPQVHPNYRVTV
NT seq 357 nt   +upstreamnt  +downstreamnt
atggccagtcagacccagggtatccagcagctcctccaggctgagaagcgggcagcggag
aaggtggccgatgccaggaagaggaaggcccggcgactgaagcaggcgaaggaggaggct
caaatggaggtggagcaataccgcagggagcgggaacaggagtttcagagcaagcagcag
gcggccatgggctctcaggggaacctgtctgctgaagtggagcaggccacaagacggcag
gttcagggcatgcagagttcccagcagaggaatcgggagcgcgtcctggctcagcttctc
ggcatggtctgtgaagtcaggccccaggtccaccccaactatcgggttactgtctag

KEGG   Mus musculus (house mouse): 66290
Entry
66290             CDS       T01002                                 
Symbol
Atp6v1g1, 1810024D14Rik, AA960677, ATP6J, Atp6g1, VAG1, Vma10
Name
(RefSeq) ATPase, H+ transporting, lysosomal V1 subunit G1
  KO
K02152  V-type H+-transporting ATPase subunit G
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu00190  Oxidative phosphorylation
mmu01100  Metabolic pathways
mmu04145  Phagosome
mmu04150  mTOR signaling pathway
mmu04721  Synaptic vesicle cycle
mmu04966  Collecting duct acid secretion
mmu05165  Human papillomavirus infection
mmu05323  Rheumatoid arthritis
Module
mmu_M00160  V-type ATPase, eukaryotes
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    66290 (Atp6v1g1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04150 mTOR signaling pathway
    66290 (Atp6v1g1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    66290 (Atp6v1g1)
 09150 Organismal Systems
  09155 Excretory system
   04966 Collecting duct acid secretion
    66290 (Atp6v1g1)
  09156 Nervous system
   04721 Synaptic vesicle cycle
    66290 (Atp6v1g1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    66290 (Atp6v1g1)
  09163 Immune disease
   05323 Rheumatoid arthritis
    66290 (Atp6v1g1)
SSDB
Motif
Pfam: V-ATPase_G FdhE DCB DUF6080 CSRNP_N MPM1 RNase_Y_N DUF2164
Other DBs
NCBI-GeneID: 66290
NCBI-ProteinID: NP_077135
MGI: 1913540
Ensembl: ENSMUSG00000039105
Vega: OTTMUSG00000000312
UniProt: Q9CR51 Q5HZY7
Position
4:63463002..63468938
AA seq 118 aa
MASQSQGIQQLLQAEKRAAEKVSEARKRKNRRLKQAKEEAQAEIEQYRLQREKEFKAKEA
AALGSHGSCSSEVEKETREKMTVLQNYFEQNRDEVLDNLLAFVCDIRPEIHENYRING
NT seq 357 nt   +upstreamnt  +downstreamnt
atggcgagtcagtcgcagggcatccagcagctactgcaggccgagaagcgggccgccgag
aaggtgtccgaggcccgcaagcgaaagaaccggaggctgaagcaggccaaagaagaagcc
caggctgaaattgaacagtaccgcctgcagagggagaaggagttcaaggccaaggaagct
gcggcattgggctcccatggcagctgcagcagtgaggtggaaaaggagacccgggagaag
atgaccgtcctccagaactacttcgagcagaacagggatgaagtcctggataacctcttg
gcctttgtgtgtgacatccggccggaaatccatgaaaactaccgcataaacggatag

KEGG   Mus musculus (house mouse): 66335
Entry
66335             CDS       T01002                                 
Symbol
Atp6v1c1, 1700025B18Rik, U13839
Name
(RefSeq) ATPase, H+ transporting, lysosomal V1 subunit C1
  KO
K02148  V-type H+-transporting ATPase subunit C
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu00190  Oxidative phosphorylation
mmu01100  Metabolic pathways
mmu04145  Phagosome
mmu04150  mTOR signaling pathway
mmu04721  Synaptic vesicle cycle
mmu04966  Collecting duct acid secretion
mmu05165  Human papillomavirus infection
mmu05323  Rheumatoid arthritis
Module
mmu_M00160  V-type ATPase, eukaryotes
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    66335 (Atp6v1c1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04150 mTOR signaling pathway
    66335 (Atp6v1c1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    66335 (Atp6v1c1)
 09150 Organismal Systems
  09155 Excretory system
   04966 Collecting duct acid secretion
    66335 (Atp6v1c1)
  09156 Nervous system
   04721 Synaptic vesicle cycle
    66335 (Atp6v1c1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    66335 (Atp6v1c1)
  09163 Immune disease
   05323 Rheumatoid arthritis
    66335 (Atp6v1c1)
SSDB
Motif
Pfam: V-ATPase_C DUF4300 NRIP1_repr_1 Folliculin
Other DBs
NCBI-GeneID: 66335
NCBI-ProteinID: NP_079770
MGI: 1913585
Ensembl: ENSMUSG00000022295
UniProt: Q9Z1G3
Position
15:38662096..38692688
AA seq 382 aa
MTEFWLISAPGEKTCQQTWEKLHAATTKNNNLAVSSKFNIPDLKVGTLDVLVGLSDELAK
LDAFVEGVVKKVAQYMADVLEDSKDKVQENLLASGVDLVTYITRFQWDMAKYPIKQSLKN
ISEIIAKGVTQIDNDLKSRASAYNNLKGNLQNLERKNAGSLLTRSLAEIVKKDDFVLDSE
YLVTLLVVVPKLNHNDWIKQYETLAEMVVPRSSNVLSEDQDSYLCNVTLFRKAVDDFRHK
ARENKFIVRDFQYNEEEMKADKEEMTRLSTDKKKQFGPLVRWLKVNFSEAFIAWIHIKAL
RVFVESVLRYGLPVNFQAMLLQPNKKSVKKLREVLHELYKHLDSSAAAIIDAPMDIPGLN
LSQQEYYPYVYYKIDCNLLEFK
NT seq 1149 nt   +upstreamnt  +downstreamnt
atgactgagttctggctcatatctgctcctggggagaaaacctgtcagcaaacatgggag
aaactacatgcagcgaccaccaagaacaataatcttgccgtctcttccaagttcaacatt
cctgacctaaaggttggcacgttggatgtcttggttggcttgtcggatgaactggctaaa
ctggatgcatttgtagaaggtgtggtcaagaaagtggctcagtacatggctgatgtgctg
gaggacagcaaagataaagttcaggagaacttgctggccagcggagttgacttggttact
tacataacaaggttccagtgggatatggctaaatatccaatcaagcagtctctgaaaaat
atttctgaaataattgccaagggagtgactcagatcgataatgacctaaagtctcgggcg
tctgcatacaataacctgaaagggaatcttcagaatttagagcgaaagaacgcgggaagt
ttgctaacgcgaagcctggcggaaatcgtgaagaaagatgactttgttcttgattcggag
tatcttgtcacattgctggtggtagttcccaagctgaaccacaatgactggattaagcag
tatgaaacgctcgcagaaatggtagtaccaaggtcaagcaatgttctttcagaggaccaa
gacagttatctttgtaacgtcaccttgtttagaaaagcagttgatgatttcagacacaaa
gccagagaaaacaagttcatagttcgtgacttccagtataacgaggaggagatgaaagca
gataaagaagaaatgaccaggctgtctactgacaagaagaagcagtttggaccacttgtg
cggtggcttaaagtgaatttcagtgaggcgtttattgcgtggattcatataaaagcatta
cgggtttttgtggagtctgttttaaggtatggcttgccggtgaacttccaagcaatgctc
cttcagccgaataagaagtcagtgaagaagctaagagaagtgctgcacgagttgtacaag
catctggacagcagtgcggctgccatcattgacgctcccatggatatccctggcctaaac
ctgagtcagcaggaatactacccctatgtgtattacaagattgattgcaacttgctggaa
ttcaagtaa

KEGG   Mus musculus (house mouse): 68775
Entry
68775             CDS       T01002                                 
Symbol
Atp6v1c2, 1110038G14Rik
Name
(RefSeq) ATPase, H+ transporting, lysosomal V1 subunit C2
  KO
K02148  V-type H+-transporting ATPase subunit C
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu00190  Oxidative phosphorylation
mmu01100  Metabolic pathways
mmu04145  Phagosome
mmu04150  mTOR signaling pathway
mmu04721  Synaptic vesicle cycle
mmu04966  Collecting duct acid secretion
mmu05165  Human papillomavirus infection
mmu05323  Rheumatoid arthritis
Module
mmu_M00160  V-type ATPase, eukaryotes
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    68775 (Atp6v1c2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04150 mTOR signaling pathway
    68775 (Atp6v1c2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    68775 (Atp6v1c2)
 09150 Organismal Systems
  09155 Excretory system
   04966 Collecting duct acid secretion
    68775 (Atp6v1c2)
  09156 Nervous system
   04721 Synaptic vesicle cycle
    68775 (Atp6v1c2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    68775 (Atp6v1c2)
  09163 Immune disease
   05323 Rheumatoid arthritis
    68775 (Atp6v1c2)
SSDB
Motif
Pfam: V-ATPase_C Na_Ca_ex_C
Other DBs
NCBI-GeneID: 68775
NCBI-ProteinID: NP_598460
MGI: 1916025
Ensembl: ENSMUSG00000020566
Vega: OTTMUSG00000023819
UniProt: Q99L60
Position
12:complement(17334722..17375700)
AA seq 427 aa
MSEFWLISAPGDKENLQALERMNNVTSKSNLSHNTKFAIPDFKVGTLDSLVGLSDELGKL
DTFAESLIKRMAQSVVEVMEDSKGKAHETLLANGVDLTSFVTHFEWDMAKYPAKQPLVSV
VDTLAKQLAQIETDLKSRTAAYSVLKANLENLEKRSTGNLFTRTLSDIVSKEDFVLDSEY
LITLLVIVPKSSFAQWQKTYESLSDMVVPRSTKLIAEDNEGGLFTVTLFRKVIEDFKVKA
KENKFIVREFYYDEKEIKREREEMTRLLSDKKQQYPTSCVALKKGSATYRDHKVKVAPLG
NPARPAAGQTDRDRESEGEGEGPLLRWLKVNFSEAFIAWIHIKALRVFVESVLRYGLPVN
FQAVLLQPHKKSATKRLREVLNSVFRHLDEVAAASILDASVEIPGLQLSNQDYFPYVYFH
IDLSLLD
NT seq 1284 nt   +upstreamnt  +downstreamnt
atgtctgagttttggcttatttcggcccctggcgataaggaaaatttacaggctctggaa
aggatgaacaatgtaacttcaaagtctaacctgtcccacaacaccaagtttgccatccca
gacttcaaggtggggactttggattcccttgttggcctctctgatgagctggggaaactc
gatacctttgctgaaagcctcataaagagaatggcacagagtgtggtggaggtcatggaa
gattccaaggggaaagcacacgagaccctcctggctaacggagttgacctgacatccttc
gtgacgcacttcgagtgggacatggccaaatatcccgccaagcagccactggtgagcgtg
gtggacacactggccaagcaactggcacaaatcgagacagacctgaagtcccggacagcc
gcctacagcgttctgaaggccaacctggagaacttggagaagagatccacggggaacctc
ttcactcggacactgagcgatattgtcagcaaggaagacttcgtacttgattctgaatat
ctcataaccctcctggtcatcgtccccaagtcaagctttgcacagtggcagaagacatat
gagtccctatcggacatggtggtccctcggtcaaccaaattgatcgccgaggacaacgaa
ggtggcctcttcacggtgactctcttccgaaaagtgatcgaagatttcaaagtcaaagcc
aaagaaaacaagttcattgtccgggaattttactatgatgaaaaagaaattaaacgagaa
agggaggagatgaccaggttgctgtctgataagaaacaacagtatccaacttcctgtgtt
gctctaaaaaagggatcagccacctaccgtgaccacaaggttaaggtagccccgctaggt
aaccctgctaggcctgctgcggggcagaccgacagagacagagagagtgagggcgagggt
gagggacctctgctgcgctggctcaaggtgaacttcagcgaggcctttattgcctggatc
cacattaaggccctgagagtgtttgtggagtctgtgctcaggtatggacttccagtgaac
ttccaggctgtgctcctacagccccataaaaagtcagccaccaaacgcctgagagaggtg
ctcaactctgtcttccggcacctggatgaagttgctgcagcaagcatactggatgcatcc
gtggagattcctggactgcagctcagcaaccaggactatttcccctatgtgtacttccat
atcgacctcagccttcttgactag

KEGG   Mus musculus (house mouse): 73834
Entry
73834             CDS       T01002                                 
Symbol
Atp6v1d, 1110004P10Rik, Atp6m, VATD, Vma8
Name
(RefSeq) ATPase, H+ transporting, lysosomal V1 subunit D
  KO
K02149  V-type H+-transporting ATPase subunit D
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu00190  Oxidative phosphorylation
mmu01100  Metabolic pathways
mmu04145  Phagosome
mmu04150  mTOR signaling pathway
mmu04721  Synaptic vesicle cycle
mmu04966  Collecting duct acid secretion
mmu05165  Human papillomavirus infection
mmu05323  Rheumatoid arthritis
Module
mmu_M00160  V-type ATPase, eukaryotes
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    73834 (Atp6v1d)
 09130 Environmental Information Processing
  09132 Signal transduction
   04150 mTOR signaling pathway
    73834 (Atp6v1d)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    73834 (Atp6v1d)
 09150 Organismal Systems
  09155 Excretory system
   04966 Collecting duct acid secretion
    73834 (Atp6v1d)
  09156 Nervous system
   04721 Synaptic vesicle cycle
    73834 (Atp6v1d)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    73834 (Atp6v1d)
  09163 Immune disease
   05323 Rheumatoid arthritis
    73834 (Atp6v1d)
SSDB
Motif
Pfam: ATP-synt_D
Other DBs
NCBI-GeneID: 73834
NCBI-ProteinID: NP_076210
MGI: 1921084
Ensembl: ENSMUSG00000021114
UniProt: P57746 Q3U861
Position
12:complement(78889756..78908810)
AA seq 247 aa
MSGKDRIEIFPSRMAQTIMKARLKGAQTGRNLLKKKSDALTLRFRQILKKIIETKMLMGE
VMREAAFSLAEAKFTAGDFSTTVIQNVNKAQVKIRAKKDNVAGVTLPVFEHYHEGTDSYE
LTGLARGGEQLAKLKRNYAKAVELLVELASLQTSFVTLDEAIKITNRRVNAIEHVIIPRI
ERTLAYIITELDEREREEFYRLKKIQEKKKIIKEKFEKDLERRRAAGEVMEPANLLAEEK
DEDLLFE
NT seq 744 nt   +upstreamnt  +downstreamnt
atgtcgggcaaagaccggattgaaatcttcccttcgcgaatggcacagaccatcatgaag
gctcgattaaaaggagcacagactggtcgaaaccttctgaagaaaaagtctgatgcctta
actcttcgatttcgacagatcctgaagaagataatagagactaaaatgctgatgggtgaa
gtgatgagagaagctgccttctcattggctgaggccaaattcacagcaggggacttcagc
accacagttatccaaaatgtaaataaagcccaagtgaagatcagagcaaagaaagacaat
gtagcaggtgttaccttgccagtgtttgaacattaccacgaaggaactgacagctatgaa
ctgaccggtttagccagaggtggggagcagctggctaaactaaagcggaattatgccaaa
gcagtggaactactggtggaactggcttccctgcagacttcctttgttaccctggatgaa
gccattaaaatcaccaacaggcgtgttaatgccattgagcatgtcattattccccggatt
gaacgcacccttgcctatatcatcacagaactggatgagagagagcgagaagaattctat
aggttaaagaaaatacaggagaagaaaaagattatcaaggaaaaatttgagaaggacttg
gagcggcggagagcagctggagaggtgatggagcctgccaacctgctggctgaagagaag
gatgaagacctgctgttcgaatag

KEGG   Mus musculus (house mouse): 74915
Entry
74915             CDS       T01002                                 
Symbol
Atp6v1e2, 4930500C14Rik, Atp6e1, E1
Name
(RefSeq) ATPase, H+ transporting, lysosomal V1 subunit E2
  KO
K02150  V-type H+-transporting ATPase subunit E
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu00190  Oxidative phosphorylation
mmu01100  Metabolic pathways
mmu04145  Phagosome
mmu04150  mTOR signaling pathway
mmu04721  Synaptic vesicle cycle
mmu04966  Collecting duct acid secretion
mmu05165  Human papillomavirus infection
mmu05323  Rheumatoid arthritis
Module
mmu_M00160  V-type ATPase, eukaryotes
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    74915 (Atp6v1e2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04150 mTOR signaling pathway
    74915 (Atp6v1e2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    74915 (Atp6v1e2)
 09150 Organismal Systems
  09155 Excretory system
   04966 Collecting duct acid secretion
    74915 (Atp6v1e2)
  09156 Nervous system
   04721 Synaptic vesicle cycle
    74915 (Atp6v1e2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    74915 (Atp6v1e2)
  09163 Immune disease
   05323 Rheumatoid arthritis
    74915 (Atp6v1e2)
SSDB
Motif
Pfam: vATP-synt_E DUF4288 HSDR_N_2 AKAP7_RIRII_bdg Folliculin
Other DBs
NCBI-GeneID: 74915
NCBI-ProteinID: NP_083397
MGI: 1922165
Ensembl: ENSMUSG00000053375
UniProt: Q9D593
Position
17:complement(87251537..87255315)
AA seq 226 aa
MALTDIDVQKQIKHMMAFIEQEANEKAEEIDAKAEEEFNIEKGRLVQTQRLKIMDYFEKK
EKQIEQQKKIQLSTMRNQARITVLRARDNLILELLKDAKMRLSRIVSDEEIYQDLLDKLV
LQALLRLLEPVMIVRCRPQDLHLVESAVLRAIPQYMRLCQKHLEVQVDQTEHLPSNAAGG
VEVYSSDQKIKVSNTLESRLNLAAMQKMPEIRGILFGDNTSRKFFT
NT seq 681 nt   +upstreamnt  +downstreamnt
atggccctgactgacatagacgtgcagaagcagatcaagcacatgatggcgttcatcgag
caggaagccaacgagaaggcggaggagatagacgccaaggcggaggaagagttcaacatt
gagaagggccgcctggtgcagacccagcggctgaagatcatggattattttgagaagaag
gagaaacagattgagcagcagaaaaagatccagctgtccaccatgagaaaccaggctcgc
atcacggtcctgagagcccgagacaatctcatcttagaattgctcaaggatgccaagatg
aggctcagcagaattgtgtcggatgaagaaatctaccaggacctgctggataagctcgtg
ctccaagccttgctccggctgctggagcctgtgatgattgtccgctgccggccacaggac
ctccacctggtggagtctgcggtgctaagagccatccctcagtacatgaggctctgccag
aagcatttggaggtacaggttgaccaaactgaacacttgccttccaatgctgctggaggg
gtggaggtctacagcagcgatcagaaaataaaggtttccaacaccctggaaagtcggctg
aatctcgcggccatgcagaagatgccagaaatacgagggattctgtttggagacaacacc
agcagaaagttctttacatga

KEGG   Mus musculus (house mouse): 76252
Entry
76252             CDS       T01002                                 
Symbol
Atp6v0e2, 0610006O14Rik, NM9.2
Name
(RefSeq) ATPase, H+ transporting, lysosomal V0 subunit E2
  KO
K02153  V-type H+-transporting ATPase subunit e
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu00190  Oxidative phosphorylation
mmu01100  Metabolic pathways
mmu04145  Phagosome
mmu04721  Synaptic vesicle cycle
mmu04966  Collecting duct acid secretion
mmu05165  Human papillomavirus infection
mmu05323  Rheumatoid arthritis
Module
mmu_M00160  V-type ATPase, eukaryotes
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    76252 (Atp6v0e2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    76252 (Atp6v0e2)
 09150 Organismal Systems
  09155 Excretory system
   04966 Collecting duct acid secretion
    76252 (Atp6v0e2)
  09156 Nervous system
   04721 Synaptic vesicle cycle
    76252 (Atp6v0e2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    76252 (Atp6v0e2)
  09163 Immune disease
   05323 Rheumatoid arthritis
    76252 (Atp6v0e2)
SSDB
Motif
Pfam: ATP_synt_H DrsE_2 Far-17a_AIG1
Other DBs
NCBI-GeneID: 76252
NCBI-ProteinID: NP_598525
MGI: 1923502
Ensembl: ENSMUSG00000039347
Vega: OTTMUSG00000057232
UniProt: Q91XE7
Position
6:48514503..48518735
AA seq 81 aa
MTAHSFALPVIIFTTFWGLIGIAGPWFVPKGPNRGVIITMLVATAVCCYLFWLIAILAQL
NPLFGPQLKNETIWYVRFLWE
NT seq 246 nt   +upstreamnt  +downstreamnt
atgacagcccattcctttgccctccctgtcatcatcttcaccacattctggggcctcatc
ggcatcgctgggccctggttcgtgcccaaaggacccaaccgcggggtgatcatcaccatg
ctggtagctactgctgtctgctgttacctcttctggctcatcgccatcttggcccaactg
aaccccctgtttgggccacaactgaagaatgagaccatctggtacgtgcgtttcctgtgg
gagtga

DBGET integrated database retrieval system