KEGG   Mus musculus (mouse): 110695
Entry
110695            CDS       T01002                                 

Gene name
Aldh7a1, Atq, Atq1, D18Wsu181, D18Wsu181e
Definition
(RefSeq) aldehyde dehydrogenase family 7, member A1
  KO
K14085  aldehyde dehydrogenase family 7 member A1 [EC:1.2.1.31 1.2.1.8 1.2.1.3]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00010  Glycolysis / Gluconeogenesis
mmu00053  Ascorbate and aldarate metabolism
mmu00071  Fatty acid degradation
mmu00260  Glycine, serine and threonine metabolism
mmu00280  Valine, leucine and isoleucine degradation
mmu00310  Lysine degradation
mmu00330  Arginine and proline metabolism
mmu00340  Histidine metabolism
mmu00380  Tryptophan metabolism
mmu00410  beta-Alanine metabolism
mmu00561  Glycerolipid metabolism
mmu00620  Pyruvate metabolism
mmu01100  Metabolic pathways
Module
mmu_M00032  Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
mmu_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
mmu_M00555  Betaine biosynthesis, choline => betaine
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    110695 (Aldh7a1)
   00053 Ascorbate and aldarate metabolism
    110695 (Aldh7a1)
   00620 Pyruvate metabolism
    110695 (Aldh7a1)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    110695 (Aldh7a1)
   00561 Glycerolipid metabolism
    110695 (Aldh7a1)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    110695 (Aldh7a1)
   00280 Valine, leucine and isoleucine degradation
    110695 (Aldh7a1)
   00310 Lysine degradation
    110695 (Aldh7a1)
   00330 Arginine and proline metabolism
    110695 (Aldh7a1)
   00340 Histidine metabolism
    110695 (Aldh7a1)
   00380 Tryptophan metabolism
    110695 (Aldh7a1)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    110695 (Aldh7a1)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     110695 (Aldh7a1)
    1.2.1.8  betaine-aldehyde dehydrogenase
     110695 (Aldh7a1)
    1.2.1.31  L-aminoadipate-semialdehyde dehydrogenase
     110695 (Aldh7a1)
SSDB
Motif
Pfam: Aldedh
Other DBs
NCBI-GeneID: 110695
NCBI-ProteinID: NP_613066
MGI: 108186
Ensembl: ENSMUSG00000053644
Vega: OTTMUSG00000035214
UniProt: Q9DBF1
Position
18 D3; 18 30.55 cM
AA seq 539 aa
MWRVPRRLCVQSVKTSKLSGPWSRPAAHMSTLLIHHPQYAWLQDLGLREDNEGVYNGSWG
GRGEVITTYCPANNEPIARVRQASLKDYEETIGKAKKAWNIWADIPAPKRGEIVRKIGDA
FREKIQLLGRLVSLEMGKILVEGIGEVQEYVDVCDYAAGLSRMIGGPTLPSERPGHALIE
MWNPLGLVGIITAFNFPVAVFGWNNAIALITGNVCLWKGAPTTSLVSVAVTKIIAQVLED
NLLPGAICSLVCGGADIGTTMARDERVNLLSFTGSTQVGKEVALMVQERFGKSLLELGGN
NAIIAFEDADLSLVVPSVLFAAVGTAGQRCTTVRRLFLHESIHNEVVDRLRSAYSQIRVG
NPWDPNILYGPLHTKQAVSMFVRAVEEAKKQGGTVVYGGKVMDHPGNYVEPTIVTGLAHD
APIVHQETFAPILYVFKFQDEEEVFEWNNEVKQGLSSSIFTKDLGRIFRWLGPKGSDCGI
VNVNIPTSGAEIGGAFGGEKHTGGGRESGSDAWKQYMRRSTCTINYSTSLPLAQGIKFQ
NT seq 1620 nt   +upstreamnt  +downstreamnt
atgtggcgtgtgccccgcaggctctgtgtgcagtctgtgaagaccagcaagctttccgga
ccttggagcaggcccgccgcccacatgtctactctgctgatccatcatccccagtatgcc
tggctgcaagacctggggctccgcgaggataacgagggcgtgtataatggaagctggggc
ggccggggagaggtaattacgacctattgtcctgctaacaatgagccaatagcaagagtc
cgacaggccagcctgaaggactatgaagaaaccatcgggaaagccaagaaagcctggaac
atctgggcagatattcctgccccaaaacgcggagaaatagtcagaaagattggcgatgcc
ttccgggagaagatccaactactgggaagactggtgtctttggagatggggaaaatcctg
gtggaaggaataggcgaggttcaggagtacgtggacgtctgcgattatgctgctggcttg
tcgaggatgatcgggggacccaccttgccttctgaaagacccggccatgctctcatcgaa
atgtggaatcccttaggcttggtgggaatcatcactgccttcaatttccccgtggctgtg
tttggctggaacaatgccatagctctgatcacagggaatgtctgcctttggaaaggagca
ccgactacgtccctcgttagtgtggctgtcacaaagatcatagcccaggttttggaggac
aacctgctgcccggtgccatttgttccctggtttgtggtggagcagatatcggcacaacg
atggccagagatgagcgtgtgaacctgctgtccttcactgggagcactcaggtggggaag
gaggtggccctcatggtgcaggagaggtttgggaaaagcttgttggagcttggaggaaac
aatgccattattgctttcgaggacgcggacctcagcttggttgttccgtcagttctgttt
gccgccgtgggaacagctgggcaaaggtgtaccactgtgaggagactgtttttgcacgaa
agcatccataatgaagttgtggacagactgagaagtgcctactcacagatccgtgttggg
aacccctgggaccccaatatcctctatggaccgctccataccaaacaggcagtgagcatg
tttgtgagagccgtggaagaagccaagaaacaagggggcacagtggtctatgggggcaag
gtcatggaccaccctggcaattacgtggaacccaccattgtgaccggtcttgcccatgat
gcgcccattgttcaccaggagacttttgccccaatcctctatgtcttcaaattccaggat
gaagaagaggtctttgaatggaacaatgaagtaaaacagggactttcaagtagtatcttt
accaaagatttgggcagaatcttccgctggcttggacctaaaggttccgactgtggcatc
gtgaacgtcaatattcctaccagcggggctgagattggtggtgcgtttggcggagagaag
cacactggcggtggccgggagtctggcagcgacgcctggaagcagtacatgaggagatcc
acatgtaccatcaactacagcacgtccctccctctggctcagggaatcaagtttcagtga

KEGG   Mus musculus (mouse): 11669
Entry
11669             CDS       T01002                                 

Gene name
Aldh2, AHD-M1, ALDH-E2, ALDHI, Ahd, Ahd-, Ahd-5, Ahd5
Definition
(RefSeq) aldehyde dehydrogenase 2, mitochondrial
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00010  Glycolysis / Gluconeogenesis
mmu00053  Ascorbate and aldarate metabolism
mmu00071  Fatty acid degradation
mmu00280  Valine, leucine and isoleucine degradation
mmu00310  Lysine degradation
mmu00330  Arginine and proline metabolism
mmu00340  Histidine metabolism
mmu00380  Tryptophan metabolism
mmu00410  beta-Alanine metabolism
mmu00561  Glycerolipid metabolism
mmu00620  Pyruvate metabolism
mmu00770  Pantothenate and CoA biosynthesis
mmu01100  Metabolic pathways
mmu01240  Biosynthesis of cofactors
Module
mmu_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    11669 (Aldh2)
   00053 Ascorbate and aldarate metabolism
    11669 (Aldh2)
   00620 Pyruvate metabolism
    11669 (Aldh2)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    11669 (Aldh2)
   00561 Glycerolipid metabolism
    11669 (Aldh2)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    11669 (Aldh2)
   00310 Lysine degradation
    11669 (Aldh2)
   00330 Arginine and proline metabolism
    11669 (Aldh2)
   00340 Histidine metabolism
    11669 (Aldh2)
   00380 Tryptophan metabolism
    11669 (Aldh2)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    11669 (Aldh2)
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    11669 (Aldh2)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     11669 (Aldh2)
SSDB
Motif
Pfam: Aldedh DUF1235
Other DBs
NCBI-GeneID: 11669
NCBI-ProteinID: NP_033786
MGI: 99600
Ensembl: ENSMUSG00000029455
Vega: OTTMUSG00000023440
UniProt: P47738 Q544B1
Position
5; 5 F
AA seq 519 aa
MLRAALTTVRRGPRLSRLLSAAATSAVPAPNHQPEVFCNQIFINNEWHDAVSRKTFPTVN
PSTGEVICQVAEGNKEDVDKAVKAARAAFQLGSPWRRMDASDRGRLLYRLADLIERDRTY
LAALETLDNGKPYVISYLVDLDMVLKCLRYYAGWADKYHGKTIPIDGDFFSYTRHEPVGV
CGQIIPWNFPLLMQAWKLGPALATGNVVVMKVAEQTPLTALYVANLIKEAGFPPGVVNIV
PGFGPTAGAAIASHEGVDKVAFTGSTEVGHLIQVAAGSSNLKRVTLELGGKSPNIIMSDA
DMDWAVEQAHFALFFNQGQCCCAGSRTFVQENVYDEFVERSVARAKSRVVGNPFDSRTEQ
GPQVDETQFKKILGYIKSGQQEGAKLLCGGGAAADRGYFIQPTVFGDVKDGMTIAKEEIF
GPVMQILKFKTIEEVVGRANDSKYGLAAAVFTKDLDKANYLSQALQAGTVWINCYDVFGA
QSPFGGYKMSGSGRELGEYGLQAYTEVKTVTVKVPQKNS
NT seq 1560 nt   +upstreamnt  +downstreamnt
atgctgcgcgccgcactcaccactgtccgccgcggaccgcgcctgagccgcctgttgtcc
gccgccgccaccagcgcggtgccagcccccaaccatcagcctgaggtcttctgcaaccag
atcttcattaacaatgagtggcacgacgccgtcagcaggaaaacatttcccaccgtcaac
ccttccacaggggaggtcatctgccaggtggccgaagggaacaaggaggacgtagacaag
gcagtgaaggctgctcgtgcagccttccagctgggctcgccctggcgccgcatggatgca
tctgaccggggccggctgttgtaccgattggcggatctcattgaacgggaccggacctac
ctagcggccttggagaccctggacaacggcaagccttatgtcatctcgtacctggtggat
ttggacatggtcctgaaatgtctccgctattacgctggctgggctgacaagtaccatggg
aaaaccattcccatcgacggcgacttcttcagctatacccgccatgagcctgtgggcgtg
tgtggacagatcattccgtggaacttcccgctcctgatgcaagcatggaaactgggccca
gccctggcaaccgggaacgtggtggtgatgaaggtggccgagcagacaccgctcaccgcg
ctctacgtggccaacttgatcaaggaggcaggctttccccctggcgtggtcaatatcgtt
cccggattcggccctaccgccggggctgccatcgcatcccatgagggtgtggacaaagtg
gcgttcacaggctccacggaggttggtcacctaatccaggtggccgccgggagcagcaac
ctcaagagagtaaccctggagctggggggaaagagtcccaacatcatcatgtccgacgct
gacatggactgggctgtggagcaggcccactttgccctgttcttcaaccagggccagtgc
tgctgcgcaggctcccggaccttcgtgcaggagaatgtgtatgacgaattcgtggaacgc
agcgtggctcgggccaagtctcgggtggtggggaaccccttcgacagccggacggagcag
gggcctcaggtggatgaaactcagtttaagaagatcctcggctacatcaaatcgggacaa
caagaaggggcgaagctgctgtgtggtgggggcgctgccgcggaccgtggctactttatc
cagcccaccgtgttcggggacgtaaaagacggcatgaccattgccaaggaggagatcttt
ggaccagtgatgcaaatcctcaaattcaagaccatcgaggaggttgtggggcgggccaat
gattctaagtatgggctggcagccgccgtcttcacaaaggacctggataaagccaattac
ctgtcccaagctctgcaggctggcactgtgtggatcaactgctacgatgtgtttggggcc
cagtctccatttgggggctataagatgtcagggagtggcagggagctgggcgagtatggc
ctgcaggcgtacacagaagtgaagacggttactgtcaaagtgccacagaagaactcgtaa

KEGG   Mus musculus (mouse): 11671
Entry
11671             CDS       T01002                                 

Gene name
Aldh3a2, AI194803, Ahd, Ahd-, Ahd-3, Ahd-3r, Ahd3, Ahd3-r, Ald, Aldh, Aldh4, Aldh4-r, FAL, FALDH
Definition
(RefSeq) aldehyde dehydrogenase family 3, subfamily A2
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00010  Glycolysis / Gluconeogenesis
mmu00053  Ascorbate and aldarate metabolism
mmu00071  Fatty acid degradation
mmu00280  Valine, leucine and isoleucine degradation
mmu00310  Lysine degradation
mmu00330  Arginine and proline metabolism
mmu00340  Histidine metabolism
mmu00380  Tryptophan metabolism
mmu00410  beta-Alanine metabolism
mmu00561  Glycerolipid metabolism
mmu00620  Pyruvate metabolism
mmu00770  Pantothenate and CoA biosynthesis
mmu01100  Metabolic pathways
mmu01240  Biosynthesis of cofactors
Module
mmu_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    11671 (Aldh3a2)
   00053 Ascorbate and aldarate metabolism
    11671 (Aldh3a2)
   00620 Pyruvate metabolism
    11671 (Aldh3a2)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    11671 (Aldh3a2)
   00561 Glycerolipid metabolism
    11671 (Aldh3a2)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    11671 (Aldh3a2)
   00310 Lysine degradation
    11671 (Aldh3a2)
   00330 Arginine and proline metabolism
    11671 (Aldh3a2)
   00340 Histidine metabolism
    11671 (Aldh3a2)
   00380 Tryptophan metabolism
    11671 (Aldh3a2)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    11671 (Aldh3a2)
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    11671 (Aldh3a2)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     11671 (Aldh3a2)
SSDB
Motif
Pfam: Aldedh LuxC Pam17
Other DBs
NCBI-GeneID: 11671
NCBI-ProteinID: NP_031463
MGI: 1353452
Ensembl: ENSMUSG00000010025
Vega: OTTMUSG00000005829
UniProt: P47740
Position
11 B2; 11 37.96 cM
AA seq 484 aa
MERQVLRLRQAFRSGRSRPLRFRLQQLEALRRMVQEREKEILAAIAADLSKSELNAYSHE
VITILGEIDFMLGNLPELASARPAKKNLLTMMDEAYVQPEPLGVVLIIGAWNYPFVLTMQ
PLVGAIAAGNAAIVKPSELSENTAKILAELLPQYLDQDLYAIVNGGIPETTELLKQRFDH
ILYTGNTAVGKIVMEAAAKHLTPVTLELGGKSPCYIDRDCDLDVACRRIAWGKYMNCGQT
CIAPDYILCEASLQNQIVQKIKETVKDFYGENIKASPDYERIINLRHFKRLQSLLKGQKI
AFGGEMDEATRYLAPTILTDVDPNSKVMQEEIFGPILPIVSVKNVDEAINFINDREKPLA
LYVFSRNNKLIKRVIDETSSGGVTGNDVIMHFTVNSLPFGGVGASGMGAYHGKYSFDTFS
HQRPCLLKGLKGESVNKLRYPPNSESKVSWAKFFLLKQFNKGRLGMLLFVCLVAVAAVIV
KDQL
NT seq 1455 nt   +upstreamnt  +downstreamnt
atggagcgccaggtcctacggcttcgccaggcgttccggtccggccgatctcggccgctg
cgcttccgattgcagcagcttgaggccctgcggaggatggtgcaagagcgcgagaaggaa
atcttagcagccatcgcggcagacctgagcaaaagtgaactcaatgcatacagtcatgaa
gtcattaccatccttggagagattgattttatgttggggaatcttcctgaattggcttct
gcgagaccggctaagaagaacctgctaaccatgatggatgaggcctacgttcagcccgag
cctctgggagtcgtactgattattggagcttggaattaccctttcgttcttaccatgcaa
ccgctggtgggagccattgctgcaggaaatgctgccattgttaagccctcagaactcagt
gaaaacacggccaagatcttggctgaactcctccctcagtacttagaccaggacctgtat
gcgattgttaatggcggtatcccggaaaccacggagcttctgaagcagcggtttgaccac
attctctatacagggaacactgcagttggaaaaattgtcatggaagctgctgccaagcat
ctgacccctgtgaccctggaactcggcgggaaaagcccttgttacattgacagagactgt
gatctggacgtggcttgcagacgcatagcctggggaaagtacatgaattgtggtcaaacc
tgcattgctcctgactatatcctgtgcgaagcctccctccagaatcaaatcgtacagaag
attaaggaaacggtgaaggacttttatggggaaaacataaaggcttctcctgactatgaa
aggatcatcaatcttcgtcactttaagaggttacaaagtctgcttaaaggccagaaaata
gctttcggtggagagatggatgaggccacacgctacttagccccaaccatacttacagat
gttgatcctaactccaaggtgatgcaagaagaaatttttggaccaattcttccaatagtg
tctgtgaaaaatgtagacgaagccataaatttcataaatgaccgtgaaaagcccctggct
ctctacgtattttctcgtaacaataagctcatcaaacgggtgatagatgagacctccagt
ggtggagtcaccggcaatgatgtcatcatgcacttcactgttaattctctgccctttgga
ggtgtgggtgccagtggaatgggggcgtatcatggaaaatacagttttgataccttttct
catcagcgcccctgcttgttaaaagggttaaagggggaaagcgtcaacaagctcaggtac
ccgcccaacagcgagtccaaggtcagctgggccaagttcttcctgctgaagcagttcaac
aaaggaaggctggggatgctgttgtttgtgtgcctggttgctgttgcagctgtgattgtc
aaggatcagctgtaa

KEGG   Mus musculus (mouse): 56752
Entry
56752             CDS       T01002                                 

Gene name
Aldh9a1, AA139417, Abaldh, ESTM4, ESTM40, TMABA-, TMABA-DH, Tmabadh
Definition
(RefSeq) aldehyde dehydrogenase 9, subfamily A1
  KO
K00149  aldehyde dehydrogenase family 9 member A1 [EC:1.2.1.47 1.2.1.3]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00010  Glycolysis / Gluconeogenesis
mmu00053  Ascorbate and aldarate metabolism
mmu00071  Fatty acid degradation
mmu00280  Valine, leucine and isoleucine degradation
mmu00310  Lysine degradation
mmu00330  Arginine and proline metabolism
mmu00340  Histidine metabolism
mmu00380  Tryptophan metabolism
mmu00410  beta-Alanine metabolism
mmu00561  Glycerolipid metabolism
mmu00620  Pyruvate metabolism
mmu01100  Metabolic pathways
Module
mmu_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    56752 (Aldh9a1)
   00053 Ascorbate and aldarate metabolism
    56752 (Aldh9a1)
   00620 Pyruvate metabolism
    56752 (Aldh9a1)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    56752 (Aldh9a1)
   00561 Glycerolipid metabolism
    56752 (Aldh9a1)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    56752 (Aldh9a1)
   00310 Lysine degradation
    56752 (Aldh9a1)
   00330 Arginine and proline metabolism
    56752 (Aldh9a1)
   00340 Histidine metabolism
    56752 (Aldh9a1)
   00380 Tryptophan metabolism
    56752 (Aldh9a1)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    56752 (Aldh9a1)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     56752 (Aldh9a1)
    1.2.1.47  4-trimethylammoniobutyraldehyde dehydrogenase
     56752 (Aldh9a1)
SSDB
Motif
Pfam: Aldedh
Other DBs
NCBI-GeneID: 56752
NCBI-ProteinID: NP_064377
MGI: 1861622
Ensembl: ENSMUSG00000026687
Vega: OTTMUSG00000050636
UniProt: Q9JLJ2 Q3U367 Q3TMT4 Q3V1N7
Position
1; 1 H2.3
AA seq 518 aa
MILGAVGSVLTSLLRIHRAAAVAAMSTGTFVVSQPLNYRGGARVEPVDASGTEKAFEPAT
GRVIATFACSGEKEVNLAVENAKAAFKLWSKKSGLERCQVLLEAARIIKERKDEIATVET
INNGKSIFEARLDVDTCWQCLEYYAGLAASMAGEHIQLPGGSFGYTRREPLGVCVGIGAW
NYPFQIACWKSAPALACGNAMIFKPSPFTPVSALLLAEIYTKAGAPPGLFNVVQGGAATG
QFLCHHREVAKISFTGSVPTGVKIMEMSAKGVKPITLELGGKSPLIIFSDCNMENAVKGA
LMANFLTQGQVCCNGTRVFVQKEIADKFINEVVKQTQKIKLGDPLLEDTRMGPLINAPHL
ERVLGFVKLAKEQGATVLCGGEVYVPEDPKLKHGYYMTPCILTNCRDDMTCVKEEIFGPV
MSILTFGTEAEVLERANDTTFGLAAGVFTRDIQRAHRVAAELQAGTCYINNYNVSPVELP
FGGYKKSGFGRENGRVTIEYYSQLKTVCVEMGDVESAF
NT seq 1557 nt   +upstreamnt  +downstreamnt
atgatcctcggtgcagtcggttctgtgctgacctcgctcctccgcattcaccgggctgca
gcagtcgccgccatgagtactggcaccttcgtcgtgtcgcagccgctcaactaccgcggc
ggggcccgtgtggagccggtggatgcttccggcacggagaaagcgttcgagccagccacc
ggccgagtgattgccactttcgcgtgttcaggagaaaaggaagtaaacttggccgttgag
aatgcaaaggctgcctttaaactctggagtaagaaaagtggcctggagcgctgccaagtc
ctcctagaggctgcccggatcatcaaggagcggaaggatgaaattgccaccgtggagacc
atcaacaacgggaagtccatatttgaggcccgcctggatgttgacacttgctggcagtgc
ctggaatactatgcagggctggctgcatccatggcaggcgagcacattcagctcccagga
gggtccttcggctacacccgaagagagccgcttggggtgtgtgtggggataggagcatgg
aactatcccttccagatcgcctgttggaagtctgctccggctctggcttgtggtaatgcc
atgatctttaagccttctcccttcacgcctgtgtctgctctgctcctggctgagatctac
accaaagcgggtgcgcctccggggctcttcaacgtggtgcaaggtggggctgccacaggc
cagtttctgtgtcatcatcgcgaggtggccaaaatctccttcaccggaagtgtgcccact
ggcgtgaagatcatggagatgtccgctaagggagtcaagcccattactttggaacttggg
ggcaaatctcctctcatcatcttctcagactgtaatatggagaatgctgtgaagggggcc
ctgatggccaacttcctcacacaaggacaggtctgctgcaatgggactagagtctttgtg
caaaaggaaattgctgataaattcataaatgaggttgtgaagcagactcagaagataaaa
cttggagacccccttctggaagatacgaggatgggcccactcatcaacgccccacatctg
gaacgagtcctcgggtttgtcaagttggcaaaggagcagggtgctactgtgctgtgtggt
ggagaggtgtatgtaccagaggaccccaaattaaaacatggatattacatgacaccttgc
attttaactaattgcagagacgacatgacttgtgtaaaagaagagatctttggaccagtc
atgtccattttaacatttggaactgaagccgaggttctagagcgagctaatgacaccact
tttggactagcagctggggtcttcaccagggacatccagagggcacaccgggtggcggct
gagctgcaggctggaacgtgctacattaacaactataatgtcagcccagtggagctgccc
tttggtggctacaagaagtcaggatttggcagagagaatggccgtgtgacgattgagtac
tactctcagctgaagacggtgtgtgtggagatgggcgacgtggagtcagccttttga

KEGG   Mus musculus (mouse): 72535
Entry
72535             CDS       T01002                                 

Gene name
Aldh1b1, 2700007F14Rik
Definition
(RefSeq) aldehyde dehydrogenase 1 family, member B1
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00010  Glycolysis / Gluconeogenesis
mmu00053  Ascorbate and aldarate metabolism
mmu00071  Fatty acid degradation
mmu00280  Valine, leucine and isoleucine degradation
mmu00310  Lysine degradation
mmu00330  Arginine and proline metabolism
mmu00340  Histidine metabolism
mmu00380  Tryptophan metabolism
mmu00410  beta-Alanine metabolism
mmu00561  Glycerolipid metabolism
mmu00620  Pyruvate metabolism
mmu00770  Pantothenate and CoA biosynthesis
mmu01100  Metabolic pathways
mmu01240  Biosynthesis of cofactors
Module
mmu_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    72535 (Aldh1b1)
   00053 Ascorbate and aldarate metabolism
    72535 (Aldh1b1)
   00620 Pyruvate metabolism
    72535 (Aldh1b1)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    72535 (Aldh1b1)
   00561 Glycerolipid metabolism
    72535 (Aldh1b1)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    72535 (Aldh1b1)
   00310 Lysine degradation
    72535 (Aldh1b1)
   00330 Arginine and proline metabolism
    72535 (Aldh1b1)
   00340 Histidine metabolism
    72535 (Aldh1b1)
   00380 Tryptophan metabolism
    72535 (Aldh1b1)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    72535 (Aldh1b1)
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    72535 (Aldh1b1)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     72535 (Aldh1b1)
SSDB
Motif
Pfam: Aldedh RHH_6
Other DBs
NCBI-GeneID: 72535
NCBI-ProteinID: NP_082546
MGI: 1919785
Ensembl: ENSMUSG00000035561
Vega: OTTMUSG00000006730
UniProt: Q9CZS1
Position
4; 4 B1
AA seq 519 aa
MLTARLLLPRLLCLQGRTTSYSTAAALPNPIPNPEICYNKLFINNEWHDAVSKKTFPTVN
PTTGEVIGHVAEGDRADVDLAVKAAREAFRLGSPWRRMDASERGRLLNRLADLVERDRVY
LASLETLDNGKPFQESYVLDLDEVIKVYRYFAGWADKWHGKTIPMDGEHFCFTRHEPVGV
CGQIIPWNFPLVMQGWKLAPALATGNTVVMKVAEQTPLSALYLASLIKEAGFPPGVVNII
TGYGPTAGAAIAQHMDVDKVAFTGSTEVGHLIQKAAGESNLKRVTLELGGKSPSIVLADA
DMEHAVDQCHEALFFNMGQCCCAGSRTFVEESIYREFLERTVEKAKQRKVGNPFELDTQQ
GPQVDKEQFERILGYIRLGQKEGAKLLCGGERLGERGFFIKPTVFGDVQDGMRIAKEEIF
GPVQPLFKFKKIEEVIQRANNTRYGLAAAVFTRDLDKAIYFTQALQAGTVWVNTYNIVTC
HTPFGGFKESGNGRELGEDGLRAYTEVKTVTIKVPEKNS
NT seq 1560 nt   +upstreamnt  +downstreamnt
atgctgactgcccgactcttgctgccccggctcctctgcctccagggcaggactacctct
tactctacagcagctgctctcccgaacccaatcccaaacccagagatttgctacaacaag
ctgttcatcaacaacgagtggcatgatgcggtcagcaaaaagaccttccccacagtgaac
cccactacaggtgaggtcattgggcatgtggccgaaggtgaccgggcagatgtggatctg
gctgtaaaagcagcccgagaagccttccgcctggggtccccatggcgcaggatggatgcc
tcagagcggggccggctgctgaaccgcctagctgatcttgtggaacgagatcgagtgtac
ttggcctcactggagacgctagataacgggaaacctttccaggagtcttatgtcttggat
ctggatgaagtcatcaaggtgtaccgttacttcgctggctgggctgacaagtggcatggt
aagaccatccctatggatggtgagcatttctgcttcacccgacatgagccagtgggtgtc
tgtggccagataatcccttggaacttcccactggtcatgcagggctggaagctggccccg
gcactcgccacgggcaacactgtggtcatgaaggtggcagagcagaccccactctctgct
ctgtacttggcctccctcatcaaagaggcggggtttcccccaggagtggtgaacatcatc
actggctacggccccacggcgggagctgccatcgctcagcacatggatgtggataaagtc
gccttcacgggctccactgaggtaggccacctgattcagaaggcagctggcgagtctaac
ctcaagagagtcaccctggagctgggtgggaagagccccagcattgtgctggcagacgct
gacatggagcatgccgtagatcagtgtcacgaagcccttttcttcaacatgggccagtgc
tgctgtgcaggctcccggacattcgtggaagagtccatctaccgtgagtttctcgagaga
actgtggagaaggccaagcagaggaaagtggggaacccctttgagttggacacccagcag
ggacctcaggtggacaaggagcagtttgaacgaatcctgggctacatccggctgggacag
aaggaaggggcaaagcttctctgtggcggggagcgtttgggggagcgcggcttcttcatc
aaacccacagtcttcggggacgttcaggatggcatgaggatcgccaaggaggagatcttt
gggcccgtgcagcctctgttcaagttcaagaagatcgaggaagtaatccagagagccaac
aacaccaggtatggcctggctgcggctgtgttcacccgagacctggacaaggccatctac
ttcacgcaggccctgcaagctgggacggtgtgggtgaacacctataacattgtcacctgc
cacacgccattcggaggctttaaggaatctggcaatggcagggagctgggggaggacggg
ctcagagcctacacggaggtgaagactgtcaccatcaaggttcccgagaagaattcctga

DBGET integrated database retrieval system