KEGG   Mus musculus (house mouse): 110877
Entry
110877            CDS       T01002                                 
Symbol
Slc18a1, 4832416I10Rik, Vat1, Vmat1
Name
(RefSeq) solute carrier family 18 (vesicular monoamine), member 1
  KO
K08155  MFS transporter, DHA1 family, solute carrier family 18 (vesicular amine transporter), member 1/2
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04721  Synaptic vesicle cycle
mmu04726  Serotonergic synapse
mmu04728  Dopaminergic synapse
mmu05012  Parkinson disease
mmu05030  Cocaine addiction
mmu05031  Amphetamine addiction
mmu05034  Alcoholism
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09156 Nervous system
   04728 Dopaminergic synapse
    110877 (Slc18a1)
   04726 Serotonergic synapse
    110877 (Slc18a1)
   04721 Synaptic vesicle cycle
    110877 (Slc18a1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05012 Parkinson disease
    110877 (Slc18a1)
  09165 Substance dependence
   05030 Cocaine addiction
    110877 (Slc18a1)
   05031 Amphetamine addiction
    110877 (Slc18a1)
   05034 Alcoholism
    110877 (Slc18a1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    110877 (Slc18a1)
Transporters [BR:mmu02000]
 Solute carrier family (SLC)
  SLC18: Vesicular amine transporter
   110877 (Slc18a1)
 Major facilitator superfamily (MFS)
  Drug transporters
   Drug:H+ antiporter-1 (12 spanner) (DHA1) family [TC:2.A.1.2]
    110877 (Slc18a1)
SSDB
Motif
Pfam: MFS_1
Other DBs
NCBI-GeneID: 110877
NCBI-ProteinID: NP_694694
MGI: 106684
Ensembl: ENSMUSG00000036330
Vega: OTTMUSG00000025652
UniProt: Q8R090 Q32XG7
Position
8:complement(69490360..69547951)
AA seq 521 aa
MFQVVLGAPQRLLKEGRQSRKLVLVVVFVALLLDNMLLTVVVPIVPTFLYATEFKDINSS
LLRGPSVSSQQALTSPAFSTTFSFFDNTTMTVEEHVPFRVAWINGTIPPPVTEAGSVPKN
NCLQGIEFLEEENVRIGILFASKALMQLLVNPFVGPLTNRIGYHIPMFVGFMIMFLSTLM
FAFSGTYALLFVARTLQGIGSSFSSVAGLGMLASVYTDNYERGRAMGIALGGLALGLLVG
APFGSVMYEFVGKSSPFLILAFLALLDGALQFCILWPSKVSPESAMGTPLLTLLKDPYIL
VAAGSICLANMGVAILEPTLPIWMMQTMCSPEWQLGLAFLPASVAYLIGTNLFGVLANKM
GRWLCSLVGMVAVGISLLCVPLAHNIFGLIGPNAGLGFAIGMVDSSLMPIMGYLVDLRHT
SVYGSVYAIADVAFCVGFAIGPSTGGVIVPVIGFPWLMVIIGTINIIYAPLCCFLQNPPA
KEEELAILNQECPTETQMYTIQRPTKEFPLGENSDDPGSEE
NT seq 1566 nt   +upstreamnt  +downstreamnt
atgttccaggttgttctgggtgctcctcagcgactgctgaaggaagggaggcagtcccgg
aagctggtgttggtggtggtgtttgtggctctactcctggacaatatgctgctcactgtg
gtggtgcccattgtgcccaccttcctgtatgcgacagagttcaaagacatcaactcttct
ctgcttaggggtccttctgtaagctcccagcaagctctcacctctcctgccttctctacc
accttctccttctttgacaacaccaccatgactgtagaagaacatgtaccttttcgtgta
gcatggataaatggtaccatccctcctccagtcaccgaagctggctcagtacctaaaaac
aactgcttgcaagggatagagttcttggaagaagaaaatgtccggattgggattctattt
gcttcaaaggctttgatgcaacttctggttaacccatttgtaggacctcttactaacagg
attggctatcacatccccatgtttgttggctttatgatcatgtttctctccacactaatg
tttgctttctctggcacctatgccctgctgtttgtggcccgaactctccaaggcattgga
tcttcattttcatctgttgcagggcttgggatgctggccagtgtctatacggataactac
gagagaggaagagccatgggaattgctttggggggcctggctttgggacttctggtggga
gcaccttttggaagtgtgatgtatgaatttgtgggcaagtcctcaccattcctcatcttg
gccttcctggcacttctggatggagctctccagttttgcatcctatggccttcgaaagtg
tctcctgagagtgccatggggactccacttttgacacttctcaaagatccttacattctg
gtagcagcaggttccatctgcctggccaacatgggagtcgccatattagagcccacgcta
cccatctggatgatgcagaccatgtgttccccggagtggcagctaggtctggctttttta
cctgccagtgtggcctacctcattggcacgaacctttttggtgtgttggccaacaagatg
ggtcggtggctgtgctcccttgttggaatggtagctgtaggtatcagcttgctctgtgta
cctctggctcacaatatttttggtcttattggacccaatgcaggccttggctttgccata
ggcatggtggattcctctctgatgcccatcatgggatacctggtggacttacgccatacc
tctgtgtatgggagtgtctatgccatcgctgatgtggctttttgtgtgggctttgctatt
ggcccatctaccgggggtgttattgtaccggtcatcggcttcccttggctcatggtcatc
attggaactatcaacatcatctatgcccctctctgctgcttcctgcagaacccaccagct
aaggaggaggagcttgcaattctgaaccaggaatgccccacagagacccagatgtacaca
atccagaggcccacgaaggagtttccactgggagagaacagcgatgatcctggcagtgag
gagtag

KEGG   Mus musculus (house mouse): 140919
Entry
140919            CDS       T01002                                 
Symbol
Slc17a6, 2900073D12Rik, DNPI, VGLUT2
Name
(RefSeq) solute carrier family 17 (sodium-dependent inorganic phosphate cotransporter), member 6
  KO
K12302  MFS transporter, ACS family, solute carrier family 17 (sodium-dependent inorganic phosphate cotransporter), member 6/7/8
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04721  Synaptic vesicle cycle
mmu04723  Retrograde endocannabinoid signaling
mmu04724  Glutamatergic synapse
mmu05033  Nicotine addiction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09156 Nervous system
   04724 Glutamatergic synapse
    140919 (Slc17a6)
   04723 Retrograde endocannabinoid signaling
    140919 (Slc17a6)
   04721 Synaptic vesicle cycle
    140919 (Slc17a6)
 09160 Human Diseases
  09165 Substance dependence
   05033 Nicotine addiction
    140919 (Slc17a6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    140919 (Slc17a6)
Transporters [BR:mmu02000]
 Solute carrier family (SLC)
  SLC17: Vesicular glutamate transporter
   140919 (Slc17a6)
 Major facilitator superfamily (MFS)
  Organic acid transporters
   Anion:cation symporter (ACS) family [TC:2.A.1.14]
    140919 (Slc17a6)
SSDB
Motif
Pfam: MFS_1 BT1
Other DBs
NCBI-GeneID: 140919
NCBI-ProteinID: NP_543129
MGI: 2156052
Ensembl: ENSMUSG00000030500
Vega: OTTMUSG00000059014
UniProt: Q8BLE7 A0A0R4J0A6
Position
7:51271578..51320874
AA seq 582 aa
MESVKQRILAPGKEGIKNFAGKSLGQIYRVLEKKQDNRETIELTEDGKPLEVPEKKAPLC
DCTCFGLPRRYIIAIMSGLGFCISFGIRCNLGVAIVDMVNNSTIHRGGKVIKEKAKFNWD
PETVGMIHGSFFWGYIITQIPGGYIASRLAANRVFGAAILLTSTLNMLIPSAARVHYGCV
IFVRILQGLVEGVTYPACHGIWSKWAPPLERSRLATTSFCGSYAGAVIAMPLAGILVQYT
GWSSVFYVYGSFGMVWYMFWLLVSYESPAKHPTITDEERRYIEESIGESANLLGAMEKFK
TPWRKFFTSMPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFEISKVGMLSAVPHLVMT
IIVPIGGQIADFLRSKQILSTTTVRKIMNCGGFGMEATLLLVVGYSHTRGVAISFLVLAV
GFSGFAISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPIIVGAMTKNKSREEWQYVF
LIAALVHYGGVIFYALFASGEKQPWADPEETSEEKCGFIHEDELDEETGDITQNYINYGT
TKSYGATSQENGGWPNGWEKKEEFVQEGAQDAYTYKDRDDYS
NT seq 1749 nt   +upstreamnt  +downstreamnt
atggagtcggtaaaacaaaggattttggccccggggaaagaggggataaagaattttgct
ggaaaatccctcggacagatctacagggtgctggagaagaagcaggacaaccgagagacc
atcgagctgacagaggacggtaagcccctggaggtgcctgagaagaaggctccgctatgc
gactgcacgtgcttcggcctgccgcgccgctacatcatagccatcatgagcggcctcggc
ttctgcatatccttcggcatccgctgtaacctgggcgtggccatcgtggacatggtcaac
aacagcactatccaccgcggaggcaaagttatcaaggagaaagccaaatttaactgggac
cccgagaccgtggggatgatccacggatcgttcttctggggctatatcatcacccagatt
ccaggaggatatatcgcatcgcggctggctgctaaccgggtctttggggctgcgatactg
ctcacctctaccctcaatatgctgatcccatctgcagccagagtgcattatggatgtgtc
atctttgttaggatattgcaaggacttgtggagggtgtcacctacccagcctgtcatggg
atatggagcaagtgggcccctcccttggagaggagtaggttggctacaacctccttttgt
ggttcctatgctggagcagtcattgcaatgcccttagctggtatccttgtgcagtacact
ggatggtcgtcagtattttatgtgtatggaagctttggcatggtctggtacatgttctgg
cttctggtgtcttatgagagccctgcaaagcatcctaccattacagatgaagaacgtagg
tacatagaggagagcattggagagagcgcaaatctgctaggtgcaatggaaaaatttaag
accccatggaggaagtttttcacatccatgcccgtctacgcgataattgttgccaacttc
tgcaggagctggactttttatttactgctcatcagtcagccagcttattttgaggaggtt
tttggatttgaaatcagcaaggttggcatgttgtctgcagtccctcaccttgtcatgaca
atcattgtgcctatcggggggcaaattgcagatttcctaaggagcaagcaaattctctca
acaactacagtgagaaagatcatgaattgtgggggttttggcatggaagccacgctgctt
ctggttgttggctactctcatactagaggggtggccatctccttcttggtgcttgcagta
ggattcagtggatttgctatctctggtttcaatgttaatcacttggatattgctccaaga
tatgccagtatcttaatgggcatttcaaatggcgttggcacgctgtcggggatggtttgc
cctatcattgttggtgcaatgacaaagaataagtcccgtgaagaatggcagtatgtcttc
ctcattgctgcactcgtccactatggtggagtcatattttatgcactatttgcctcagga
gagaaacaaccttgggcagaccctgaggaaacaagcgaagaaaaatgtggcttcattcac
gaagatgaactggatgaagaaacgggggacatcactcagaattacataaattacggtacc
accaaatcttacggtgctacctcacaggagaatggaggctggcctaacggctgggagaaa
aaggaagaatttgtgcaagaaggtgcgcaagacgcgtacacctataaggaccgagatgat
tattcataa

KEGG   Mus musculus (house mouse): 20508
Entry
20508             CDS       T01002                                 
Symbol
Slc18a3, VAChT, VAT
Name
(RefSeq) solute carrier family 18 (vesicular monoamine), member 3
  KO
K14636  MFS transporter, DHA1 family, solute carrier family 18 (vesicular acetylcholine transporter), member 3
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04721  Synaptic vesicle cycle
mmu04725  Cholinergic synapse
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09156 Nervous system
   04725 Cholinergic synapse
    20508 (Slc18a3)
   04721 Synaptic vesicle cycle
    20508 (Slc18a3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    20508 (Slc18a3)
Transporters [BR:mmu02000]
 Solute carrier family (SLC)
  SLC18: Vesicular amine transporter
   20508 (Slc18a3)
 Major facilitator superfamily (MFS)
  Drug transporters
   Drug:H+ antiporter-1 (12 spanner) (DHA1) family [TC:2.A.1.2]
    20508 (Slc18a3)
SSDB
Motif
Pfam: MFS_1 Sugar_tr MFS_4
Other DBs
NCBI-GeneID: 20508
NCBI-ProteinID: NP_068358
MGI: 1101061
Ensembl: ENSMUSG00000100241
Vega: OTTMUSG00000049703
UniProt: Q3TYJ1
Position
14:complement(32184394..32186807)
AA seq 530 aa
MEPTAPTGQARAAATKLSEAVGAALQEPQRQRRLVLVIVCVALLLDNMLYMVIVPIVPDY
IAHMRGGSESPTLISEVWEPTLPPPTLANASAYLANTSASPTAAGSARSILRPRYPTESE
DVKIGVLFASKAILQLLVNPLSGPFIDRMSYDVPLLIGLGVMFASTVMFAFAEDYATLFA
ARSLQGLGSAFADTSGIAMIADKYPEEPERSRALGVALAFISFGSLVAPPFGGILYEFAG
KRVPFLVLAAVSLFDALLLLAVAKPFSAAARARANLPVGTPIHRLMLDPYIAVVAGALTT
CNIPLAFLEPTIATWMKHTMAASEWEMGMVWLPAFVPHVLGVYLTVRLAARYPHLQWLYG
ALGLAVIGVSSCVVPACRSFAPLVVSLCGLCFGIALVDTALLPTLAFLVDVRHVSVYGSV
YAIADISYSVAYALGPIVAGHIVHSLGFEQLSLGMGLANLLYAPVLLLLRNVGLLTRSRS
ERDVLLDEPPQGLYDAMRLREVQGKDGGEPCSPPGPFDGCEDDYNYYSRS
NT seq 1593 nt   +upstreamnt  +downstreamnt
atggaacccaccgcgccaaccggtcaggcccgggcggcggccaccaagctgtcggaagca
gtgggagccgcgctacaagagccccagaggcagcggcgcctggtgctggtcatcgtgtgc
gttgcactgttactggacaacatgttgtacatggtcatcgtgcccattgttcccgactat
atcgctcacatgcgcgggggcagcgagagccctaccctgatctctgaggtgtgggaaccc
accctgccgccgcccactctggctaatgccagcgcctacttggccaacacctcggcgtcc
ccgacggctgccgggtcggctcggtcaatcctgcggcctcgctaccccacagaaagtgaa
gatgtgaagataggcgtgctatttgcctccaaggccatcctgcagcttctggtgaacccc
ttaagcgggcctttcattgatcgcatgagctacgacgtgccgctgcttattggcctgggc
gtcatgttcgcctccacagtcatgtttgcctttgcagaagactatgccacgctcttcgct
gcgcgcagtctacaaggcctgggctcagccttcgcggacacgtctggcattgccatgatc
gccgacaagtatcccgaggagcctgagcgcagtcgtgctctgggcgtggcgctagccttc
atcagctttggaagcctagtggcgccaccgtttgggggcatcctctacgagttcgcgggc
aagcgtgtaccctttctagtgctcgccgccgtgtcgctcttcgacgcactcctactcctg
gcggtggctaagcctttctcagctgcggctcgggcgcgggccaacctgcccgtgggcaca
cctatccatcgcctcatgctagacccttacatcgctgttgtagccggagcgctcacaact
tgtaacattccccttgcgtttctcgagcccaccatagccacgtggatgaagcacacaatg
gcggcatccgagtgggagatgggcatggtttggctgccggctttcgtgccacacgtgtta
ggcgtctatctcaccgtgcgtctagcggcgcgctatccacacctgcagtggctgtatggc
gctctcgggctagcggtaatcggagtgagctcttgcgtcgtacctgcctgccgatccttc
gcgcccttagtggtctcgctctgcggcctctgcttcggcatcgcgttggtggacacggcg
ctcctacccacgctcgcctttctggtggacgtgcgccacgtatcagtctatggcagtgtc
tatgccatagctgacatctcctattctgtggcctacgctctcgggcccatagtagcaggc
catatcgttcactcacttggctttgagcagctcagccttggcatgggcctggccaacctg
ctctacgcaccggtcctattgctcttgcgtaatgtgggcctccttacacgctcgcgttcc
gagcgcgatgtgctgcttgatgaaccgccgcagggtctgtacgacgcgatgcgcctgcgt
gaggtgcagggcaaggacggcggtgaaccttgtagcccgcctggcccttttgatggctgt
gaggacgactacaactactactcccgcagctag

KEGG   Mus musculus (house mouse): 214084
Entry
214084            CDS       T01002                                 
Symbol
Slc18a2, 1110037L13Rik, 9330105E13, Vmat2
Name
(RefSeq) solute carrier family 18 (vesicular monoamine), member 2
  KO
K08155  MFS transporter, DHA1 family, solute carrier family 18 (vesicular amine transporter), member 1/2
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04721  Synaptic vesicle cycle
mmu04726  Serotonergic synapse
mmu04728  Dopaminergic synapse
mmu05012  Parkinson disease
mmu05030  Cocaine addiction
mmu05031  Amphetamine addiction
mmu05034  Alcoholism
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09156 Nervous system
   04728 Dopaminergic synapse
    214084 (Slc18a2)
   04726 Serotonergic synapse
    214084 (Slc18a2)
   04721 Synaptic vesicle cycle
    214084 (Slc18a2)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05012 Parkinson disease
    214084 (Slc18a2)
  09165 Substance dependence
   05030 Cocaine addiction
    214084 (Slc18a2)
   05031 Amphetamine addiction
    214084 (Slc18a2)
   05034 Alcoholism
    214084 (Slc18a2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    214084 (Slc18a2)
Transporters [BR:mmu02000]
 Solute carrier family (SLC)
  SLC18: Vesicular amine transporter
   214084 (Slc18a2)
 Major facilitator superfamily (MFS)
  Drug transporters
   Drug:H+ antiporter-1 (12 spanner) (DHA1) family [TC:2.A.1.2]
    214084 (Slc18a2)
SSDB
Motif
Pfam: MFS_1 Sugar_tr S_4TM
Other DBs
NCBI-GeneID: 214084
NCBI-ProteinID: NP_766111
MGI: 106677
Ensembl: ENSMUSG00000025094
UniProt: Q8BRU6
Position
19:59249310..59284444
AA seq 517 aa
MALSDLVLLRWLRDSRHSRKLILFIVFLALLLDNMLLTVVVPIIPSYLYSIKHEKNTTEI
QTARPALTASTSESFHSIFSYYNNSTVFTGNATGGLPGGESPKATTTQHTVTNTTVPPDC
PSEDKDLLNENVQVGLLFASKATVQLLTNPFIGLLTNRIGYPIPMFAGFCIMFISTVMFA
FSSSYAFLLIARSLQGIGSSCSSVAGMGMLASVYTDDEERGNAMGIALGGLAMGVLVGPP
FGSVLYEFVGKTAPFLVLAALVLLDGAIQLFVLQPSRVQPESQKGTPLTTLLKDPYILIA
AGSICFANMGIAMLEPALPIWMMETMCSRKWQLGVAFLPASISYLIGTNIFGILAHKMGR
WLCALLGMIVVGISILCIPFAKNIYGLIAPNFGVGFAIGMVDSSMMPIMGYLVDLRHVSV
YGSVYAIADVAFCMGYAIGPSAGGAIAKAIGFPWLMTIIGIIDIVFAPLCFFLRSPPAKE
EKMAILMDHNCPIKTKMYTQNNVQPYPVGDDEESESD
NT seq 1554 nt   +upstreamnt  +downstreamnt
atggccctgagcgatctggtgctgctgcgatggctgcgggacagccgccactcgcgcaag
ctgatcctgttcatcgtgttcctcgcgctgctgctagacaacatgctgctcaccgtcgta
gttcccatcattcccagctacctgtacagcattaagcacgagaaaaatactacggaaatc
cagactgccaggccagcgctcacagcctccacttccgaaagcttccacagcatcttctct
tactataacaactctactgtgttcacggggaatgccacggggggcctcccaggaggggag
tcacccaaggctaccaccacacagcacactgtgaccaacacgactgtccctcccgactgc
cccagtgaagacaaagaccttctaaatgagaatgtgcaagttgggctgctgtttgcctcc
aaagccactgtccagctcctcaccaacccattcataggacttctaaccaacagaattggc
tatccaattcccatgtttgctggattctgcattatgtttatctcaacagttatgtttgcc
ttctccagcagctatgccttcctgctgatcgccaggtccctgcagggaatcggctcctct
tgctcatctgtggctgggatgggcatgctggccagcgtgtacacagatgatgaagagagg
ggtaacgccatggggattgctctggggggcctggccatgggggtcttagtgggacccccc
tttggaagtgtgctctatgagtttgtggggaagacagctcctttcctggtgcttgctgcc
ttggtgctcttggatggagctattcagctctttgtgctccagccatcccgagtgcagcca
gaaagtcagaaggggacacctcttacgaccttgctgaaggacccatacattctcatcgct
gcaggctccatctgctttgcaaacatggggatagccatgctggagcccgccctgcccatc
tggatgatggagaccatgtgttcccgaaagtggcagctgggcgttgccttcctgccagcg
agcatctcttatctcattggaaccaatatttttgggatacttgcacacaaaatgggaagg
tggctgtgtgctcttctgggaatgatagttgttgggatcagcattttatgtattcctttt
gcaaaaaatatctacggactcatcgctcccaactttggagttggttttgccattgggatg
gtggactcctccatgatgcctatcatgggctacctggtggacctgcggcacgtgtctgtc
tatgggagtgtgtatgccattgcagatgtagccttctgcatggggtatgctatcggtccc
tctgctggtggtgctattgcaaaggcaattggctttccttggctcatgacaattattggg
ataattgatattgtttttgctccactctgcttttttcttcgaagtccacctgctaaggaa
gaaaaaatggctatcctcatggaccacaactgccccattaagacaaagatgtacactcag
aataatgtccagccgtaccccgtcggtgatgatgaagaatctgagagtgactga

KEGG   Mus musculus (house mouse): 216227
Entry
216227            CDS       T01002                                 
Symbol
Slc17a8, BC042593, Vglut3
Name
(RefSeq) solute carrier family 17 (sodium-dependent inorganic phosphate cotransporter), member 8
  KO
K12302  MFS transporter, ACS family, solute carrier family 17 (sodium-dependent inorganic phosphate cotransporter), member 6/7/8
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04721  Synaptic vesicle cycle
mmu04723  Retrograde endocannabinoid signaling
mmu04724  Glutamatergic synapse
mmu05033  Nicotine addiction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09156 Nervous system
   04724 Glutamatergic synapse
    216227 (Slc17a8)
   04723 Retrograde endocannabinoid signaling
    216227 (Slc17a8)
   04721 Synaptic vesicle cycle
    216227 (Slc17a8)
 09160 Human Diseases
  09165 Substance dependence
   05033 Nicotine addiction
    216227 (Slc17a8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    216227 (Slc17a8)
Transporters [BR:mmu02000]
 Solute carrier family (SLC)
  SLC17: Vesicular glutamate transporter
   216227 (Slc17a8)
 Major facilitator superfamily (MFS)
  Organic acid transporters
   Anion:cation symporter (ACS) family [TC:2.A.1.14]
    216227 (Slc17a8)
SSDB
Motif
Pfam: MFS_1 BT1
Other DBs
NCBI-GeneID: 216227
NCBI-ProteinID: NP_892004
MGI: 3039629
Ensembl: ENSMUSG00000019935
Vega: OTTMUSG00000024564
UniProt: Q8BFU8
Position
10:complement(89409882..89457111)
AA seq 601 aa
MPFKAFDTFKEKILKPGKEGVKNAVGDSLGILQRKIDGTNEEEDAIELNEEGRPVQTSRA
HRPVCDCSCCGIPKRYICDCSCCGIPKRYIIAVMSGLGFCISFGIRCNLGVAIVEMVNNS
TVYVDGKPEIQTAQFNWDPETVGLIHGSFFWGYIVTQIPGGFISNKFAASRVFGAAIFLT
STLNMFIPSAARVHYGCVMGVRILQGLVEGVTYPACHGMWSKWAPPLERSRLATTSFCGS
YAGAVVAMPLAGVLVQYIGWASVFYIYGMFGIIWYMFWLLQAYECPAAHPTISNAERTYI
ETSIGEGANLASLSKFNTPWRRFFTSLPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGF
AISKVGLLSAVPHMVMTIVVPIGGQLADYLRSRKILTTTAVRKIMNCGGFGMEATLLLVV
GFSHTKGVAISFLVLAVGFSGFAISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPLI
VGAMTKHKTREEWQNVFLIAALVHYSGVIFYGVFASGEKQDWADPENLSEDKCGIIDQDE
LAEETELNHETFVSPRKKMSYGATTQNCEVQKTEWRQQRESAFDGEEPLSYQAEGDFSET
S
NT seq 1806 nt   +upstreamnt  +downstreamnt
atgccatttaaagcatttgataccttcaaagaaaagattttgaaacctgggaaggaagga
gtgaagaatgccgtgggagactcgctgggcatcttacaaagaaaaatcgatgggaccaat
gaagaggaagatgccattgagctgaatgaagaaggaaggcccgtgcagacgtccagagca
catcgccctgtctgtgactgcagctgctgcggcatccccaagcggtacatctgtgactgc
agctgctgcggcatccccaaacggtacatcattgctgtcatgagcggcctcggcttctgc
atttcctttgggattcggtgcaaccttggagtggccattgtggaaatggtcaacaatagc
actgtgtatgtggatgggaaaccagaaattcagacagcgcagtttaactgggacccagag
acggtgggcctgatccatggatcttttttctggggttatattgtgacacaaattcccggt
ggcttcatttcaaacaagtttgctgctagcagggtctttggagccgccatcttcttgaca
tcaactctgaacatgtttatcccttctgcggcgagggtgcattacggctgtgtcatgggt
gtgaggattttgcagggtctggtggagggtgtgacctaccctgcctgccatgggatgtgg
agtaagtgggcgcctcccctggagagaagccgtctagccacgacttccttctgtggttcc
tatgctggggcagttgttgctatgcctcttgcaggggtattggtgcagtacattggctgg
gcctctgtcttttacatctacggtatgtttgggattatttggtatatgttttggctgctg
caggcttatgagtgcccggcagctcacccaacaatatccaatgcagaaaggacctacata
gagacaagcataggagaaggggccaacttggccagtctgagcaaattcaacacaccatgg
agaaggtttttcacatccttgcctgtctatgccatcattgtggcaaacttctgtagaagc
tggaccttctatttgctcctgataagtcagccagcttactttgaggaggtctttggattt
gcaataagtaaggtgggtctcttgtcagctgtcccacacatggtgatgacaatcgtggtg
cccatcggaggacaactggctgattatttaagaagccgaaagattttgaccacaaccgct
gtcagaaagatcatgaattgtggaggctttggcatggaggcaaccttgctcctggtggtt
ggattttcccataccaaaggagtggctatctccttcctggtgcttgctgtaggatttagt
ggctttgctatttcaggcttcaatgtcaaccacctggacattgctccacgctatgccagc
atcctcatggggatctcaaatggtgtggggaccctctctggaatggtttgtcccctcatt
gttggtgcaatgactaagcacaagacccgggaggagtggcagaatgtgttcctcatagca
gcgctggtacactacagcggagtcatcttctacggggtcttcgcttctggggaaaaacag
gactgggctgacccagagaatctctctgaggacaaatgtggaatcattgaccaagatgag
ttagctgaggagacagaactcaaccacgagactttcgtaagtcccagaaagaagatgtct
tatggagccaccacccagaattgtgaggtccagaagacggagtggagacaacagagagaa
tctgccttcgacggggaggagccattatcctaccaggccgaaggagacttctcagaaaca
tcctaa

KEGG   Mus musculus (house mouse): 22348
Entry
22348             CDS       T01002                                 
Symbol
Slc32a1, R75019, VGAT, Viaat
Name
(RefSeq) solute carrier family 32 (GABA vesicular transporter), member 1
  KO
K15015  solute carrier family 32 (vesicular inhibitory amino acid transporter)
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04721  Synaptic vesicle cycle
mmu04723  Retrograde endocannabinoid signaling
mmu04727  GABAergic synapse
mmu05032  Morphine addiction
mmu05033  Nicotine addiction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09156 Nervous system
   04727 GABAergic synapse
    22348 (Slc32a1)
   04723 Retrograde endocannabinoid signaling
    22348 (Slc32a1)
   04721 Synaptic vesicle cycle
    22348 (Slc32a1)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    22348 (Slc32a1)
   05033 Nicotine addiction
    22348 (Slc32a1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    22348 (Slc32a1)
Transporters [BR:mmu02000]
 Solute carrier family (SLC)
  SLC32: Vesicular inhibitory amino acid transporter
   22348 (Slc32a1)
SSDB
Motif
Pfam: Aa_trans
Other DBs
NCBI-GeneID: 22348
NCBI-ProteinID: NP_033534
MGI: 1194488
Ensembl: ENSMUSG00000037771
Vega: OTTMUSG00000015925
UniProt: O35633 Q49S98
Position
2:158449180..158457667
AA seq 525 aa
MATLLRSKLTNVATSVSNKSQAKVSGMFARMGFQAATDEEAVGFAHCDDLDFEHRQGLQM
DILKSEGEPCGDEGAEAPVEGDIHYQRGGAPLPPSGSKDQAVGAGGEFGGHDKPKITAWE
AGWNVTNAIQGMFVLGLPYAILHGGYLGLFLIIFAAVVCCYTGKILIACLYEENEDGEVV
RVRDSYVAIANACCAPRFPTLGGRVVNVAQIIELVMTCILYVVVSGNLMYNSFPGLPVSQ
KSWSIIATAVLLPCAFLKNLKAVSKFSLLCTLAHFVINILVIAYCLSRARDWAWEKVKFY
IDVKKFPISIGIIVFSYTSQIFLPSLEGNMQQPSEFHCMMNWTHIAACVLKGLFALVAYL
TWADETKEVITDNLPGSIRAVVNLFLVAKALLSYPLPFFAAVEVLEKSLFQEGSRAFFPA
CYGGDGRLKSWGLTLRCALVVFTLLMAIYVPHFALLMGLTGSLTGAGLCFLLPSLFHLRL
LWRKLLWHQVFFDVAIFVIGGICSVSGFVHSLEGLIEAYRTNAED
NT seq 1578 nt   +upstreamnt  +downstreamnt
atggccaccctgctccgcagcaagctgaccaatgtggccacctccgtgtccaacaagtcc
caggccaaggtgagcggcatgtttgccaggatggggtttcaggcggccaccgatgaggaa
gcggtgggcttcgcgcactgcgacgatctcgactttgagcatcgccagggcctgcagatg
gacatcctgaaatcggaaggcgagccctgcggagacgagggcgcagaagctcccgtcgag
ggagacattcattatcagcgcggcggcgctcctctgccaccctctggctccaaggaccag
gccgtgggagctggtggggagttcgggggtcacgacaaacccaagatcacggcgtgggaa
gcgggctggaacgtgacaaatgccattcagggcatgttcgtgctgggcctaccctacgcc
atcctccacggcggctacctggggttgttcctcatcatcttcgccgcagtggtgtgctgc
tacaccggcaagatcctcatcgcgtgcctgtacgaggagaacgaagacggggaggtggtg
cgcgtgcgggactcgtatgtggccatagctaacgcatgctgcgctcctcgattccccacc
ctgggcggccgcgtggtcaatgtggcgcagatcatcgagctggtgatgacgtgtatcttg
tacgtcgtggtgagcggcaacctcatgtacaacagtttcccggggctgcccgtgtcgcag
aagtcctggtccatcatagccacagcggtgctgctgccctgcgccttcctgaagaatctc
aaggccgtgtccaagttcagtctgctgtgtacgctggcccacttcgtcatcaacatcctg
gtcatcgcttactgtctctctcgcgcgcgtgattgggcctgggagaaggtgaagttctac
atcgacgtcaagaagtttcccatctccattggcatcatcgtgttcagctacacgtcgcag
atcttcctgccctctctcgaaggcaacatgcagcagcccagcgaattccactgcatgatg
aactggacacacatcgccgcctgcgtgctcaagggtctcttcgcgctcgtcgcctacctc
acctgggccgacgagaccaaggaagtcatcacggataacctgcccggctccatccgcgcc
gtggtcaacctcttcctggtggccaaggcgctgctgtcctatccgttgcccttcttcgcg
gccgtcgaagtgctggagaagtctctcttccaggaaggcagtcgcgccttcttccccgcc
tgctatggaggcgacggtcgccttaagtcctgggggctgacgctgcgctgcgcgctggtg
gtcttcacgctgctcatggccatctacgtgccacacttcgcgctgctcatgggcctcacg
ggcagcctcacaggcgccggcctctgcttcctgctgcccagcctcttccacttgcgcctt
ctctggcgcaagctgctgtggcaccaggtcttcttcgatgtggccatcttcgtcatcggc
ggcatctgcagcgtgtccggcttcgtgcattcactcgagggtctcatcgaggcctaccga
accaacgcagaggactag

KEGG   Mus musculus (house mouse): 72961
Entry
72961             CDS       T01002                                 
Symbol
Slc17a7, 2900052E22Rik, AI851913, Vglut1
Name
(RefSeq) solute carrier family 17 (sodium-dependent inorganic phosphate cotransporter), member 7
  KO
K12302  MFS transporter, ACS family, solute carrier family 17 (sodium-dependent inorganic phosphate cotransporter), member 6/7/8
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04721  Synaptic vesicle cycle
mmu04723  Retrograde endocannabinoid signaling
mmu04724  Glutamatergic synapse
mmu05033  Nicotine addiction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09156 Nervous system
   04724 Glutamatergic synapse
    72961 (Slc17a7)
   04723 Retrograde endocannabinoid signaling
    72961 (Slc17a7)
   04721 Synaptic vesicle cycle
    72961 (Slc17a7)
 09160 Human Diseases
  09165 Substance dependence
   05033 Nicotine addiction
    72961 (Slc17a7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    72961 (Slc17a7)
Transporters [BR:mmu02000]
 Solute carrier family (SLC)
  SLC17: Vesicular glutamate transporter
   72961 (Slc17a7)
 Major facilitator superfamily (MFS)
  Organic acid transporters
   Anion:cation symporter (ACS) family [TC:2.A.1.14]
    72961 (Slc17a7)
SSDB
Motif
Pfam: MFS_1
Other DBs
NCBI-GeneID: 72961
NCBI-ProteinID: NP_892038
MGI: 1920211
Ensembl: ENSMUSG00000070570
Vega: OTTMUSG00000058649
UniProt: Q3TXX4 Q8JZR7
Position
7:44813345..44825563
AA seq 560 aa
MEFRQEEFRKLAGRALGRLHRLLEKRQEGAETLELSADGRPVTTHTRDPPVVDCTCFGLP
RRYIIAIMSGLGFCISFGIRCNLGVAIVSMVNNSTTHRGGHVVVQKAQFNWDPETVGLIH
GSFFWGYIVTQIPGGFICQKFAANRVFGFAIVATSTLNMLIPSAARVHYGCVIFVRILQG
LVEGVTYPACHGIWSKWAPPLERSRLATTAFCGSYAGAVVAMPLAGVLVQYSGWSSVFYV
YGSFGIFWYLFWLLVSYESPALHPSISEEERKYIEDAIGESAKLMNPVTKFNTPWRRFFT
SMPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFEISKVGLVSALPHLVMTIIVPIGGQ
IADFLRSRHIMSTTNVRKLMNCGGFGMEATLLLVVGYSHSKGVAISFLVLAVGFSGFAIS
GFNVNHLDIAPRYASILMGISNGVGTLSGMVCPIIVGAMTKHKTREEWQYVFLIASLVHY
GGVIFYGVFASGEKQPWAEPEEMSEEKCGFVGHDQLAGSDESEMEDEAEPPGAPPAPPPS
YGATHSTVQPPRPPPPVRDY
NT seq 1683 nt   +upstreamnt  +downstreamnt
atggagttccggcaggaggagtttcggaagctggcggggcgcgccctggggaggctgcac
cggttactggagaagcggcaggaaggcgcggagacactggagctgagtgccgacgggcgg
ccagtgaccacgcacactcgggacccgcctgtggtggactgcacctgctttggcctccct
cgtcgctacatcatcgccatcatgagcggtctgggtttctgtatcagctttggcatccgc
tgcaacctgggcgtggccatcgtgtccatggtcaacaacagcacaacccaccgtgggggc
cacgtggtggtgcagaaagcccagttcaactgggatccagagactgtcggcctcatacat
ggctcctttttctggggctacattgtcactcagattcctggaggatttatctgccaaaaa
ttcgcagccaacagggtctttggctttgccattgtggctacctccaccctaaacatgttg
atcccttcagcagcccgcgttcactatggctgtgtcatcttcgtgaggatccttcaggga
ttggtggagggggtcacataccctgcttgccatggcatctggagcaaatgggcccctccc
ttagaacggagtcggctggcaacgacagccttttgcggttcctatgctggggcggtggtt
gccatgcccttggctggggtccttgtgcagtattcaggatggagttctgtcttctatgtc
tatggcagcttcgggatcttttggtacctgttctggttgcttgtctcctatgagtcaccg
gcactgcaccccagcatctctgaggaggagcgcaaatacattgaggatgccatcggggag
agcgccaagctcatgaaccctgttacgaagtttaacacaccctggaggcgcttctttacg
tccatgcccgtctatgccatcatcgttgcgaacttttgccgcagctggaccttctacctg
ctcctcatctctcagcccgcctactttgaagaagtgttcggctttgagatcagcaaggtg
gggctggtgtcggcgctgcctcaccttgtcatgaccatcatcgtacccattggaggccag
atcgctgactttttgcgcagtcgtcacataatgtccactaccaacgtgcgaaagctcatg
aactgcgggggtttcgggatggaagccacgctgctgctggtggtcggatactcgcactcc
aagggcgtggccatctccttcctggtcctggctgtgggcttcagtggctttgccatctct
gggtttaacgtgaaccacttggacatcgcccctcgctatgccagcatcttgatgggcatt
tccaatggcgtgggcacactgtctgggatggtgtgccccatcatcgtgggtgcaatgacc
aagcacaagacgcgggaggagtggcagtacgtgttcctcatagcctccctggtgcactac
ggcggtgtcatcttctatggggtctttgcttcgggagagaagcagccgtgggcagagccg
gaggagatgagcgaggagaagtgtggctttgttggccacgaccagctggctggcagtgac
gaaagtgaaatggaggacgaggctgagcccccaggggcgccccccgcgccgcctccgtcc
tacggggccacacacagcacagtgcagcctccgaggcccccgccccctgtccgggactac
tga

DBGET integrated database retrieval system