KEGG   Mus musculus (mouse): 110891
Entry
110891            CDS       T01002                                 

Symbol
Slc8a2, Ncx, Ncx2
Name
(RefSeq) solute carrier family 8 (sodium/calcium exchanger), member 2
  KO
K05849  solute carrier family 8 (sodium/calcium exchanger)
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04020  Calcium signaling pathway
mmu04022  cGMP-PKG signaling pathway
mmu04260  Cardiac muscle contraction
mmu04261  Adrenergic signaling in cardiomyocytes
mmu04371  Apelin signaling pathway
mmu04740  Olfactory transduction
mmu04961  Endocrine and other factor-regulated calcium reabsorption
mmu04974  Protein digestion and absorption
mmu04978  Mineral absorption
mmu05410  Hypertrophic cardiomyopathy
mmu05412  Arrhythmogenic right ventricular cardiomyopathy
mmu05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    110891 (Slc8a2)
   04020 Calcium signaling pathway
    110891 (Slc8a2)
   04022 cGMP-PKG signaling pathway
    110891 (Slc8a2)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    110891 (Slc8a2)
   04261 Adrenergic signaling in cardiomyocytes
    110891 (Slc8a2)
  09154 Digestive system
   04974 Protein digestion and absorption
    110891 (Slc8a2)
   04978 Mineral absorption
    110891 (Slc8a2)
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    110891 (Slc8a2)
  09157 Sensory system
   04740 Olfactory transduction
    110891 (Slc8a2)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    110891 (Slc8a2)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    110891 (Slc8a2)
   05414 Dilated cardiomyopathy
    110891 (Slc8a2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    110891 (Slc8a2)
   00536 Glycosaminoglycan binding proteins [BR:mmu00536]
    110891 (Slc8a2)
Transporters [BR:mmu02000]
 Solute carrier family (SLC)
  SLC8: Na+/Ca2+ exchanger
   110891 (Slc8a2)
Glycosaminoglycan binding proteins [BR:mmu00536]
 Heparan sulfate / Heparin
  Others
   110891 (Slc8a2)
SSDB
Motif
Pfam: Calx-beta Na_Ca_ex Na_Ca_ex_C
Other DBs
NCBI-GeneID: 110891
NCBI-ProteinID: NP_683748
MGI: 107996
Ensembl: ENSMUSG00000030376
Vega: OTTMUSG00000060705
UniProt: Q8K596
Position
7 A2; 7 8.75 cM
AA seq 921 aa
MAPLALMGVVLLLGVPHCLGEATPTPSLPPPTANDSDASPEGCQGSYRCQPGVLLPVWEP
EDPSLGDKVARAVVYFVAMVYMFLGVSIIADRFMASIEVITSKEKEITITKANGETSVGT
VRIWNETVSNLTLMALGSSAPEILLTVIEVCGHNFQAGELGPGTIVGSAAFNMFVVIAVC
VYVIPAGESRKIKHLRVFFVTASWSIFAYVWLYLILAVFSPGVVQVWEALLTLIFFPVCV
VFAWMADKRLLFYKYVYKRYRTDPRSGIIIGAEGDPPKSIELDGTFVGTEVPGELGALGT
GPAEARELDASRREVIQILKDLKQKHPDKDLEQLMGIAKYYALLHQQKSRAFYRIQATRL
MTGAGNVLRRHAADAARRPGATDGAPDDEDDGASRIFFEPSLYHCLENCGSVLLSVACQG
GEGNSTFYVDYRTEDGSAKAGSDYEYSEGTLVFKPGETQKDLRIGIIDDDIFEEDEHFFV
RLLNLRVGDAQGMFEPDGGGRPKGRLVAPLLATVTILDDDHAGIFSFQDRLLHVSECMGT
VDVRVVRSSGARGTVRLPYRTVDGTARGGGVHYEDACGELEFGDDETMKTLQVKIVDDEE
YEKKDNFFIELGQPQWLKRGISALLLNQGNGDKKITAEQEEAQRIAEMGKPVLGENNRLE
VIIEESYDFKNTVDKLIKKTNLALVIGTHSWREQFIEAVTVSAGDEEEDEDGPREERLPS
CFDYVMHFLTVFWKVLFACVPPTEYCNGWACFGVCILVIGVLTALIGDLASHFGCTVGLK
DSVNAVVFVALGTSIPDTFASKVAALQDQCADASIGNVTGSNAVNVFLGLGVAWSVAAVY
WAVQGRPFEVRAGTLAFSVTLFTVFAFVCIAVLLYRRRPQIGGELGGPRGPKLATTALFL
GLWFLYILFSSLEAYCHIRGF
NT seq 2766 nt   +upstreamnt  +downstreamnt
atggctcccttggctttgatgggggttgttctccttctgggggtaccccactgcttgggg
gaagccactccgaccccttccctaccgcctcccacagctaatgacagcgatgccagccca
gaaggctgccaaggttcctaccgctgccaaccaggtgtgctgctgcctgtgtgggaaccc
gaggacccatcgctgggcgacaaggttgcacgggccgtggtgtactttgtggccatggtc
tacatgttcctgggtgtgtctatcattgccgatcgatttatggcatccattgaggtcatc
acatccaaggagaaagagatcaccatcaccaaggcaaatggggagaccagcgtgggcacg
gtgcgcatctggaacgagacggtgtccaaccttacactcatggccctgggctcctcagcg
cctgagattctgttgactgtcatcgaggtctgtggccacaacttccaggccggtgagcta
ggcccaggcaccatcgtgggcagtgccgccttcaacatgtttgtggtcattgctgtttgt
gtgtatgtcatcccggctggcgagagccgtaagatcaagcacctgagggtcttctttgtc
acagcctcctggagcatctttgcctatgtctggctttatctcattctagcagttttctcc
ccaggtgtagtccaggtgtgggaggcactgctcacactgatcttcttcccggtgtgtgtg
gtgtttgcctggatggcggacaagcgactgctcttctacaagtacgtgtacaagcgctac
cgcaccgaccctcgcagtggaatcatcatcggggcagagggagacccacccaagagcatc
gagctggacggcacattcgtgggcactgaggtccctggcgagctgggcgcattgggcaca
ggtcctgctgaggcgcgtgaactagatgccagccggcgtgaggtcatccagatccttaag
gacttgaagcagaagcacccggataaggacctggagcagctgatgggcatcgccaagtac
tatgcactgctgcaccagcagaagagccgcgccttctaccgcatccaggccacgcggctg
atgacaggtgcgggcaatgtgctgcgcagacatgctgcggatgctgcccgcaggccggga
gccaccgatggtgcccccgatgatgaggacgatggtgccagtcgcatcttctttgagccc
agcctctatcactgcctggaaaactgcgggtcagtgctgctgtccgtggcttgccagggc
ggtgagggcaacagcaccttctacgtggactaccgtaccgaggacggttctgcaaaggca
ggctccgattatgagtacagcgagggcacgctggtgttcaagcccggggagacgcagaag
gacctgcgcatcgggatcatcgacgacgacatcttcgaggaggatgagcacttcttcgtg
aggctgctgaacctgcgtgtgggcgatgctcagggcatgttcgagcccgacggcggtggg
cggcccaaggggcggctggtggcgccgctgctggccactgtcaccatcctggacgacgac
cacgcgggcatcttctccttccaggaccgcctgctgcatgtgagcgagtgcatgggcact
gtggatgtgcgcgtggttcgcagctcgggcgcccgtggcactgtacgcctcccctaccgc
acagtggacggcacggcccgtggcggtggtgtacattacgaggatgcttgtggagagctg
gagttcggcgatgatgagaccatgaaaactcttcaggtcaagatagtggatgatgaagag
tatgagaagaaggacaacttcttcattgagctgggccagccccagtggcttaagcgaggc
atctcagctctgctactcaaccaagggaatggagacaagaagataactgcagagcaggag
gaggcccagaggatagcagagatgggcaagccagttcttggggagaacaatcgcctcgag
gtcatcatcgaggagtcttatgactttaagaacacggtggataaactcataaagaaaacg
aacctggccttggtgattgggactcactcatggagggagcagtttatagaggcagttacc
gtaagcgcaggggacgaggaggaggatgaggatggacctcgtgaggagcggctgccgtcc
tgctttgactacgtgatgcacttcctgacggtattctggaaagttctattcgcctgcgtt
ccacccacggagtactgcaatggctgggcctgctttggtgtctgcatcctggtcattggt
gtgctcactgccctcatcggagacctggcctcacactttgggtgcaccgtgggcctcaag
gactcagtcaacgccgtggtcttcgtagccctgggcacctccatccctgacacgttcgcc
agcaaggtggccgcgctgcaggaccagtgtgccgacgcgtccatcggtaacgtgaccggc
tccaatgcggtgaacgtgttcctgggcctgggtgtggcctggtcggtggcagcggtatac
tgggcggtgcagggtcgccccttcgaggtgcgtgcaggcacgctggccttctcggtcacg
ctgttcaccgtcttcgccttcgtgtgcatcgcagtgctgttgtaccggcgccggccgcag
attggcggcgagctgggcggcccgcggggacccaagctggccaccaccgctctcttcctg
ggcctctggttcctctacattctcttctccagcctggaggcttactgccacatccggggc
ttctag

KEGG   Mus musculus (mouse): 110893
Entry
110893            CDS       T01002                                 

Symbol
Slc8a3, AW742262, Ncx, Ncx3
Name
(RefSeq) solute carrier family 8 (sodium/calcium exchanger), member 3
  KO
K05849  solute carrier family 8 (sodium/calcium exchanger)
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04020  Calcium signaling pathway
mmu04022  cGMP-PKG signaling pathway
mmu04260  Cardiac muscle contraction
mmu04261  Adrenergic signaling in cardiomyocytes
mmu04371  Apelin signaling pathway
mmu04740  Olfactory transduction
mmu04961  Endocrine and other factor-regulated calcium reabsorption
mmu04974  Protein digestion and absorption
mmu04978  Mineral absorption
mmu05410  Hypertrophic cardiomyopathy
mmu05412  Arrhythmogenic right ventricular cardiomyopathy
mmu05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    110893 (Slc8a3)
   04020 Calcium signaling pathway
    110893 (Slc8a3)
   04022 cGMP-PKG signaling pathway
    110893 (Slc8a3)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    110893 (Slc8a3)
   04261 Adrenergic signaling in cardiomyocytes
    110893 (Slc8a3)
  09154 Digestive system
   04974 Protein digestion and absorption
    110893 (Slc8a3)
   04978 Mineral absorption
    110893 (Slc8a3)
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    110893 (Slc8a3)
  09157 Sensory system
   04740 Olfactory transduction
    110893 (Slc8a3)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    110893 (Slc8a3)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    110893 (Slc8a3)
   05414 Dilated cardiomyopathy
    110893 (Slc8a3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    110893 (Slc8a3)
   00536 Glycosaminoglycan binding proteins [BR:mmu00536]
    110893 (Slc8a3)
Transporters [BR:mmu02000]
 Solute carrier family (SLC)
  SLC8: Na+/Ca2+ exchanger
   110893 (Slc8a3)
Glycosaminoglycan binding proteins [BR:mmu00536]
 Heparan sulfate / Heparin
  Others
   110893 (Slc8a3)
SSDB
Motif
Pfam: Calx-beta Na_Ca_ex Na_Ca_ex_C
Other DBs
NCBI-GeneID: 110893
NCBI-ProteinID: NP_536688
MGI: 107976
Ensembl: ENSMUSG00000079055
Vega: OTTMUSG00000044361
UniProt: S4R2P9 Q8BXN1 Q3UTP5
Position
12 D1; 12 37.44 cM
AA seq 928 aa
MAWLRLQPLTSAFLHFGLVTFVLFLNCLRAEAGDSGDVPSAGQNNESCSGSSDCKEGVIL
PIWYPENPSLGDKIARVIVYFVALIYMFLGVSIIADRFMASIEVITSQEREVTIKKPNGE
TSTTTIRVWNETVSNLTLMALGSSAPEILLSLIEVCGHGFIAGDLGPSTIVGSAAFNMFI
IIGICVYVIPDGETRKIKHLRVFFVTAAWSIFAYIWLYMILAVFSPGVVQVWEGLLTLFF
FPVCVLLAWVADKRLLFYKYMHKKYRTDKHRGIIIETEGDHPKGIEMDGKMMNSHFLDGN
FTPLEGKEVDESRREMIRILKDLKQKHPEKDLDQLVEMANYYALSHQQKSRAFYRIQATR
MMTGAGNILKKHAAEQAKKTSSMSEVHTDEPEDFASKVFFDPCSYQCLENCGAVLLTVVR
KGGDISKTMYVDYKTEDGSANAGADYEFTEGTVVLKPGETQKEFSVGIIDDDIFEEDEHF
FVRLSNVRVEEEQLAEGMLPAILNSLPLPRAVLASPCVATVTILDDDHAGIFTFECDTIH
VSESIGVMEVKVLRTSGARGTVIVPFRTVEGTAKGGGEDFEDAYGELEFKNDETVKTIHI
KVIDDKAYEKNKNYVIEMMGPRMVDMSVQKALLLSPEVTDRKLTVEEEEAKRIAEMGKPV
LGEHPKLEVIIEESYEFKSTVDKLIKKTNLALVVGTHSWRDQFMEAITVSAGGDEDEDES
GEERLPSCFDYVMHFLTVFWKVLFACVPPTEYCHGWACFVVSILIIGMLTAIIGDLASHF
GCTIGLKDSVTAVVFVAFGTSVPDTFASKAAALQDVYADASIGNVTGSNAVNVFLGIGLA
WSVAAIYWAMQGQEFHVSAGTLAFSVTLFTIFAFVCLSVLLYRRRPHLGGELGGPRGCKL
ATTWLFVSLWLLYILFATLEAYCYIKGF
NT seq 2787 nt   +upstreamnt  +downstreamnt
atggcgtggttacggctgcagcctctcacctctgccttcctccattttgggctggttact
tttgtgctcttcctgaattgtcttcgagcagaggctggtgactcgggggatgtgcccagt
gcagggcagaacaatgagtcctgttcggggtcatcagactgcaaggagggtgtcattttg
ccaatctggtatccagagaacccttcccttggggacaagattgccagggtcattgtctat
tttgtggccctgatatacatgtttcttggggtgtctatcattgctgaccgattcatggca
tctattgaagtcattacttcccaagagagggaagtgaccatcaagaagcccaatggagag
accagcacaactacaattcgggtatggaatgaaactgtctccaatctgaccctgatggcc
ctgggctcttctgctccagagattctcctgtctttaattgaggtgtgtggtcacgggttc
attgctggtgatctgggaccatctaccatcgttggcagtgcagccttcaacatgttcatc
atcattggcatctgtgtctatgtgatcccagatggggagactcgaaagatcaagcacctg
cgagtcttcttcgtcacggctgcttggagcatcttcgcctacatttggctctatatgatc
ctggcagtcttctctcctggtgtggtccaggtttgggaaggcctccttactctcttcttc
tttcccgtgtgtgtcctgctggcttgggtggcagataagcgactgctcttctacaaatac
atgcacaaaaaataccgcacagataaacaccgaggaattatcattgagacagagggtgac
caccctaagggcattgagatggatgggaaaatgatgaattctcactttctagatgggaac
tttacacctttggaaggaaaggaggtagatgaatctcgcagggaaatgatccggattcta
aaggatctgaaacaaaaacacccagaaaaggacctagatcagctggtggagatggccaat
tactatgctctttcccatcaacagaagagccgtgctttctaccgcatccaagccacccgg
atgatgactggtgcgggcaatatacttaagaagcatgcagccgagcaagccaagaagacc
tccagcatgagcgaggtgcataccgatgagccggaggactttgcctctaaggtcttcttt
gacccatgttcttatcagtgcctggagaactgtggagctgtcctcctgaccgtggtgagg
aaagggggagatatatccaagaccatgtacgtggactacaaaacagaggacggctccgcc
aatgcaggggcagactatgagttcacagagggcactgtggttctgaagccaggagagacc
cagaaggagttctctgtgggcatcattgatgatgacatttttgaggaggatgaacacttc
tttgtgaggctgagcaatgtccgtgtagaagaggagcagctggcggaggggatgctccca
gcaatactcaatagtcttcctttgcctcgggctgtcctggcctccccttgtgtggccaca
gtaaccatcttggatgatgaccatgcaggaattttcacttttgaatgtgataccattcat
gtcagtgaaagtattggtgttatggaagtcaaggttttgaggacatcaggtgccaggggc
acagtcatcgtcccttttaggacagtagaagggacagccaagggtggtggcgaggacttt
gaagatgcatatggggagctggagttcaagaatgatgaaacagtcaaaacaattcacatc
aaggtaattgatgataaggcgtatgagaaaaacaagaattacgtcattgagatgatgggc
ccccgcatggtggatatgagtgttcagaaagcgctcctgttatctccagaagtgacagac
aggaagctgactgtggaggaagaggaagccaagagaatagcagagatgggaaagccagta
ttgggtgaacaccccaaactagaggtcatcattgaagagtcctatgagttcaagagtaca
gtggataagctgatcaagaagacaaacctggcattggttgtggggacccattcctggagg
gaccagttcatggaagccatcactgttagtgcaggaggggatgaggatgaagacgaatct
ggagaggagaggctgccatcctgctttgactacgtcatgcacttcctgacggtcttctgg
aaggtgctctttgcctgtgtgccccccacagagtactgccacggctgggcctgcttcgtg
gtctccatcctcattattggcatgctcaccgccatcatcggggacctggcctctcacttc
ggctgcaccatcgggctcaaggattcggtcacagctgttgtttttgtggcattcggcacc
tctgtgccagatacatttgccagcaaagccgctgccctgcaggacgtgtatgcagatgct
tccattggcaacgtcacaggcagtaatgccgtcaatgtcttcctgggtattggtttggcc
tggtccgtggccgccatctactgggccatgcagggacaggagttccatgtgtccgctggc
actctggccttctcggtcactcttttcaccatctttgcatttgtctgcctcagtgtgctc
ttgtatcgtcggcggccccatctgggcggggagctcggaggtcctcgtggctgcaagctt
gccacgacatggctctttgtgagcctatggctcctctacatactatttgccacgctggag
gcctactgctacatcaaggggttctga

KEGG   Mus musculus (mouse): 20541
Entry
20541             CDS       T01002                                 

Symbol
Slc8a1, AI852629, AV344025, D930008O12Rik, Ncx, Ncx1
Name
(RefSeq) solute carrier family 8 (sodium/calcium exchanger), member 1
  KO
K05849  solute carrier family 8 (sodium/calcium exchanger)
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04020  Calcium signaling pathway
mmu04022  cGMP-PKG signaling pathway
mmu04260  Cardiac muscle contraction
mmu04261  Adrenergic signaling in cardiomyocytes
mmu04371  Apelin signaling pathway
mmu04740  Olfactory transduction
mmu04961  Endocrine and other factor-regulated calcium reabsorption
mmu04974  Protein digestion and absorption
mmu04978  Mineral absorption
mmu05410  Hypertrophic cardiomyopathy
mmu05412  Arrhythmogenic right ventricular cardiomyopathy
mmu05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    20541 (Slc8a1)
   04020 Calcium signaling pathway
    20541 (Slc8a1)
   04022 cGMP-PKG signaling pathway
    20541 (Slc8a1)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    20541 (Slc8a1)
   04261 Adrenergic signaling in cardiomyocytes
    20541 (Slc8a1)
  09154 Digestive system
   04974 Protein digestion and absorption
    20541 (Slc8a1)
   04978 Mineral absorption
    20541 (Slc8a1)
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    20541 (Slc8a1)
  09157 Sensory system
   04740 Olfactory transduction
    20541 (Slc8a1)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    20541 (Slc8a1)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    20541 (Slc8a1)
   05414 Dilated cardiomyopathy
    20541 (Slc8a1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    20541 (Slc8a1)
   00536 Glycosaminoglycan binding proteins [BR:mmu00536]
    20541 (Slc8a1)
Transporters [BR:mmu02000]
 Solute carrier family (SLC)
  SLC8: Na+/Ca2+ exchanger
   20541 (Slc8a1)
Glycosaminoglycan binding proteins [BR:mmu00536]
 Heparan sulfate / Heparin
  Others
   20541 (Slc8a1)
SSDB
Motif
Pfam: Calx-beta Na_Ca_ex Na_Ca_ex_C DnaG_DnaB_bind
Other DBs
NCBI-GeneID: 20541
NCBI-ProteinID: NP_035536
MGI: 107956
Ensembl: ENSMUSG00000054640
UniProt: P70414 G3X9J1 Q68FL0
Position
17 E3; 17 51.29 cM
AA seq 970 aa
MLRLSLPPNVSMGFRLVALVALLFSHVDHITADTEAETGGNETTECTGSYYCKKGVILPI
WEPQDPSFGDKIARATVYFVAMVYMFLGVSIIADRFMSSIEVITSQEKEITIKKPNGETT
KTTVRIWNETVSNLTLMALGSSAPEILLSVIEVCGHNFTAGDLGPSTIVGSAAFNMFIII
ALCVYVVPDGETRKIKHLRVFFVTAAWSIFAYTWLYIILSVSSPGVVEVWEGLLTFFFFP
ICVVFAWVADRRLLFYKYVYKRYRAGKQRGMIIEHEGDRPASKTEIEMDGKVVNSHVDNF
LDGALVLEVDERDQDDEEARREMARILKELKQKHPEKEIEQLIELANYQVLSQQQKSRAF
YRIQATRLMTGAGNILKRHAADQARKAVSMHEVNMEMAENDPVSKIFFEQGTYQCLENCG
TVALTIMRRGGDLSTTVFVDFRTEDGTANAGSDYEFTEGTVIFKPGETQKEIRVGIIDDD
IFEEDENFLVHLSNVRVSSDVSEDGILESNHASSIACLGSPSTATITIFDDDHAGIFTFE
EPVTHVSESIGIMEVKVLRTSGARGNVIIPYKTIEGTARGGGEDFEDTCGELEFQNDEIV
KTISVKVIDDEEYEKNKTFFIEIGEPRLVEMSEKKALLLNELGGFTLTGKEMYGQPIFRK
VHARDHPIPSTVITISEEYDDKQPLTSKEEEERRIAEMGRPILGEHTKLEVIIEESYEFK
STVDKLIKKTNLALVVGTNSWREQFIEAITVSAGEDDDDDECGEEKLPSCFDYVMHFLTV
FWKVLFAFVPPTEYWNGWACFIVSILMIGLLTAFIGDLASHFGCTIGLKDSVTAVVFVAL
GTSVPDTFASKVAATQDQYADASIGNVTGSNAVNVFLGIGVAWSIAAIYHAANGEQFKVS
PGTLAFSVTLFTIFAFINVGVLLYRRRPEIGGELGGPRTAKLLTSSLFVLLWLLYIFFSS
LEAYCHIKGF
NT seq 2913 nt   +upstreamnt  +downstreamnt
atgcttcgattaagtctcccacccaatgtttcaatgggatttcgtctggtagctctggtg
gctctcttgttttcccatgttgaccatataactgcagatacagaggcagaaacaggagga
aatgaaaccactgaatgtactggctcatattactgtaagaaaggggtgatcttgcccatt
tgggaaccccaagacccatcttttggggacaaaattgctagagcaactgtgtattttgtg
gccatggtctacatgttccttggagtttctattattgcagaccggtttatgtcctctata
gaggtcatcacctctcaagagaaagaaataacgataaagaaaccgaatggagagaccacc
aagacgacggtgagaatctggaacgagactgtgtcgaacctgaccttgatggccctggga
tcttctgctcctgagattctcctgtcagtcattgaagtgtgcggccataacttcaccgca
ggggacctgggtcccagcaccatcgtgggaagtgctgcctttaacatgttcatcataatc
gcactctgtgtttacgtggtccctgatggagagacaaggaagatcaagcatctgcgtgtg
ttctttgtgacagcagcctggagcatctttgcctatacctggctttatataatcttgtct
gtcagctctcctggagttgtggaggtctgggaaggcttgcttactttcttcttctttccc
atctgcgttgtgttcgcgtgggtagcagacaggcggcttctcttttacaagtatgtctac
aagcggtacagggccggcaagcagagggggatgatcattgaacatgaaggagacagacca
gcttccaaaactgaaatcgaaatggatgggaaagtggtcaactctcatgttgacaatttc
ttagatggggctctggttttggaagttgatgagagggaccaagatgatgaggaagccagg
cgtgagatggcaaggattctgaaggaacttaagcagaagcatcctgagaaagaaattgag
caattaatagaattagccaactaccaggtcctaagtcaacagcagaaaagccgagcattt
tacaggattcaagctactcgcctgatgaccggagctggcaacatcttgaagaggcacgca
gctgatcaagcaaggaaggctgtcagtatgcatgaagtcaacatggaaatggctgaaaac
gacccagtcagtaagatcttctttgagcaaggaacataccagtgtctagagaactgtggt
actgtggccctcaccattatgcgcagagggggcgacttgagcaccactgtgtttgttgac
ttcaggacagaagacggcacagccaatgctgggtctgattatgaattcacggaagggact
gtgatcttcaaaccaggggagacccagaaggaaatcagagttggcatcattgatgatgat
atctttgaagaagatgaaaacttccttgtgcatcttagcaatgtcagagtctcttcagat
gtttcagaagatggcatactagaatccaatcacgcttcttcaattgcttgtcttgggtca
cccagcactgccaccataaccatttttgatgatgaccatgcaggcatctttacatttgag
gaacccgtgactcacgtgagcgagagcattggcatcatggaggtgaaggttttgagaacc
tctggagctcgaggaaatgttatcattccctacaaaactattgaaggcacagcccgaggt
ggaggggaagactttgaggacacctgtggagagctcgaattccagaacgatgaaatagtc
aaaacaatatcagtcaaggtaatcgatgacgaggagtatgagaaaaacaagaccttcttc
attgagattggagagccccgtctggtggagatgagtgagaagaaagccctgttgttgaat
gagcttggtggcttcacattaacaggaaaagagatgtatggccaacctatcttcaggaag
gtccatgctagagatcatccgattccctctactgtaatcaccatctcagaggaatatgat
gacaagcagccactgaccagcaaagaagaggaggagaggcgcattgcggaaatggggcgc
cccatcctaggcgagcacaccaagctggaggtgatcatcgaagagtcttacgaattcaag
agcactgtggacaaactcattaagaagacgaacctggcccttgtggtggggaccaacagc
tggagagagcagtttatcgaagccatcactgtcagcgctggggaagatgacgatgatgat
gaatgtggggaggagaagctgccctcctgttttgattacgtgatgcactttctcacagtg
ttctggaaggttctgtttgccttcgtcccacctacagaatactggaatggctgggcctgc
ttcattgtctccatcctcatgatcggcctactgaccgccttcattggagacctggcttcc
cactttggctgcaccattggtctgaaagattccgtgactgccgttgtgtttgttgctctt
ggaacctcggtgccagacacatttgccagcaaagtagcagctacccaggaccagtatgca
gatgcgtctataggcaatgtcactggaagcaatgctgtgaatgtcttcctgggaatcggc
gtggcctggtccattgctgccatctaccatgcggccaacggggaacagttcaaagtgtcc
cccggcacgctagctttctctgtcactctcttcactatttttgctttcatcaacgtgggg
gtgctgctgtatcggcggaggccagaaataggaggtgagctgggagggccccggactgcc
aagctcctcacatcttccctgtttgtgctcctgtggctcttgtacattttcttctcctcc
ctggaagcctactgccacataaagggcttctaa

DBGET integrated database retrieval system