KEGG   Mus musculus (mouse): 11409
Entry
11409             CDS       T01002                                 

Gene name
Acads, AI196007, Bcd-1, Bcd1, Hdlq, Hdlq8, SC, SCAD
Definition
(RefSeq) acyl-Coenzyme A dehydrogenase, short chain
  KO
K00248  butyryl-CoA dehydrogenase [EC:1.3.8.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00071  Fatty acid degradation
mmu00280  Valine, leucine and isoleucine degradation
mmu00410  beta-Alanine metabolism
mmu00640  Propanoate metabolism
mmu00650  Butanoate metabolism
mmu01100  Metabolic pathways
mmu01200  Carbon metabolism
mmu01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    11409 (Acads)
   00650 Butanoate metabolism
    11409 (Acads)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    11409 (Acads)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    11409 (Acads)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    11409 (Acads)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.8  With a flavin as acceptor
    1.3.8.1  short-chain acyl-CoA dehydrogenase
     11409 (Acads)
SSDB
Motif
Pfam: Acyl-CoA_dh_1 Acyl-CoA_dh_N Acyl-CoA_dh_M Acyl-CoA_dh_2 HpaB_N
Other DBs
NCBI-GeneID: 11409
NCBI-ProteinID: NP_031409
MGI: 87868
Ensembl: ENSMUSG00000029545
Vega: OTTMUSG00000014625
UniProt: Q07417
Position
5 55.99 cM; 5 F
AA seq 412 aa
MAAALLARARGPLRRALGVRDWRRLHTVYQSVELPETHQMLRQTCRDFAEKELVPIAAQL
DREHLFPTAQVKKMGELGLLAMDVPEELSGAGLDYLAYSIALEEISRACASTGVIMSVNN
SLYLGPILKFGSAQQKQQWITPFTNGDKIGCFALSEPGNGSDAGAASTTAREEGDSWVLN
GTKAWITNSWEASATVVFASTDRSRQNKGISAFLVPMPTPGLTLGKKEDKLGIRASSTAN
LIFEDCRIPKENLLGEPGMGFKIAMQTLDMGRIGIASQALGIAQASLDCAVKYAENRNAF
GAPLTKLQNIQFKLADMALALESARLLTWRAAMLKDNKKPFTKESAMAKLAASEAATAIS
HQAIQILGGMGYVTEMPAERYYRDARITEIYEGTSEIQRLVIAGHLLRSYRS
NT seq 1239 nt   +upstreamnt  +downstreamnt
atggctgccgccttgctcgcccgggcccgtggccctctccgtagagctctcggtgttcgg
gactggcgacggttacacactgtttaccagtctgtggagctgcctgagacacaccagatg
ttgcgtcagacatgccgtgactttgccgagaaggagttggtccccattgcggcccagctg
gacagggagcatctcttccccacagctcaggttaagaagatgggtgagctcgggctgctg
gccatggatgtgccagaggagctgagtggtgcaggcttggattacctggcctactccatc
gccctggaggagatcagccgtgcctgcgcctccacgggagttatcatgagcgtcaacaat
tctctctacttgggacccattctgaagtttggatccgcacagcagaagcaacagtggatc
acccctttcaccaatggtgacaaaatcggctgttttgccctcagtgagccaggcaatggc
agtgatgctggagccgcttccaccactgcccgggaagagggtgactcatgggtcctcaac
ggcaccaaagcttggatcaccaactcctgggaggcttccgccacggtggtatttgccagc
acagacaggtcccggcagaacaagggtatcagtgccttcctggttcccatgccaactcct
gggctcacgctgggcaagaaggaagacaagctgggcatccgggcctcctccacagctaac
ctcatctttgaggactgccggatccccaaggagaacctgcttggggagcctgggatgggc
ttcaaaatagccatgcaaaccctggacatgggtcgcattggcatcgcctcccaggccctg
ggcatcgcccaggcctccctggattgtgctgtgaagtatgccgagaaccgcaatgccttt
ggggcaccgctcaccaagctccaaaatatccagttcaagctggcagacatggccctggcc
ctggagagtgcccgcctgctgacctggcgtgctgccatgttgaaagacaacaagaaacct
ttcaccaaggagtccgccatggccaaactggctgcatcggaggctgcaaccgccattagc
caccaggccatccagatcctgggcggcatggggtatgtgacagagatgccggctgagcgg
tactaccgagatgcccgcatcactgagatctacgaagggaccagcgaaatccagagactg
gtgatcgctgggcatctgctccggagctaccggagctga

DBGET integrated database retrieval system