KEGG   Mus musculus (house mouse): 116837
Entry
116837            CDS       T01002                                 
Symbol
Rims1, C030033M19Rik, RIM1, RIM1a, RIM1alpha, Rab3ip1, Rim, Serg1
Name
(RefSeq) regulating synaptic membrane exocytosis 1
  KO
K15291  regulating synaptic membrane exocytosis protein 1
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04721  Synaptic vesicle cycle
mmu04723  Retrograde endocannabinoid signaling
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    116837 (Rims1)
   04721 Synaptic vesicle cycle
    116837 (Rims1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    116837 (Rims1)
Membrane trafficking [BR:mmu04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Acrosomal exocytosis proteins
    116837 (Rims1)
  Small GTPases and associated proteins
   Rab associated proteins
    116837 (Rims1)
SSDB
Motif
Pfam: C2 PDZ FYVE_2 PDZ_6 Nudix_N_2 IBR
Other DBs
NCBI-GeneID: 116837
NCBI-ProteinID: NP_001012643
MGI: 2152971
Ensembl: ENSMUSG00000041670
UniProt: Q99NE5
Position
1:complement(22356196..22845239)
AA seq 1477 aa
MSSAVGPRGPRPPTVPPPMQELPDLSHLTEEERNIIMAVMDRQKEEEEKEEAMLKCVVRD
MAKPAACKTPRNAESQPHQPPLNIFRCVCVPRKPSSEEGGPDRNWRLHQQFESYKEQVRK
IGEEARRYQGEHKDDAPTCGICHKTKFADGCGHLCSYCRTKFCARCGGRVSLRSNNEDKV
VMWVCNLCRKQQEILTKSGAWFFGSGPQQPSQDGTLSDTATGAGSEVPREKKARLQERSR
SQTPLSTAAVSSQDTASHGAPLDRNKGAEPSQQALGPEQKQASRSRSEPPRERKKAPGLS
EQNGKGGQKSERKRVPKSVVQPGEGTADERERKERRETRRLEKGRSQDYPDRLEKREDGR
VAEDEKQRKEEEYQTRYRSDPNLARYPVKAPLEEQQMRMHARVSRARHERRHSDVALPHT
EAAAAVSAETTAGKRAQTTARVSPPESPRARAPAAQPPAEHGPPPPRPAPGPAEPPEPRV
PEPLRKQGRLDPGSAVLLRKAKREKAESMLRNDSLSSDQSESVRPSPPKPHRPKRGGKRR
QMSVSSSEEEGVSTPEYTSCEDVELESESVSEKGDLDYWLDPATWHSRETSPISSHPVTW
QPSKEGDRLIGRVILNKRTTMPKESGALLGLKVVGGKMTDLGRLGAFITKVKKGSLADVV
GHLRAGDEVLEWNGKPLPGATNEEVYNIILESKSEPQVEIIVSRPIGDIPRIPESSHPPL
ESSSSSFESQKMERPSISVISPTSPGALKDAPQVLPGQLSVKLWYDKVGHQLIVNVLQAT
DLPPRVDGRPRNPYVKMYFLPDRSDKSKRRTKTVKKLLEPKWNQTFVYSHVHRRDFRERM
LEITVWDQPRVQDEESEFLGEILIELETALLDDEPHWYKLQTHDESSLPLPQPSPFMPRR
HIHGESSSKKLQRSQRISDSDISDYEVDDGIGVVPPVGYRASARESKATTLTVPEQQRTT
HHRSRSVSPHRGDDQGRPRSRLPNVPLQRSLDEIHPTRRSRSPTRHHDASRSLADHRSRH
AESQYSSEPDRTHRQGSPTQSPPADTSFGSRRGRQLPQVPVRSGSIEQASLVVEERTRQM
KMKVHRFKQTTGSGSSQELDHEQYSKYNIHKDQYRSCDNASAKSSDSDVSDVSAISRASS
TSRLSSTSFMSEQSERPRGRISSFTPKMQGRRMGTSGRAIIKSTSVSGEIYTLEHNDGSQ
SDTAVGTVGAGGKKRRSSLSAKVVAIVSRRSRSTSQLSQTESGHKKLKSTIQRSTETGMA
AEMRKMVRQPSRESTDGSINSYSSEGNLIFPGVRVGPDSQFSDFLDGLGPAQLVGRQTLA
TPAMGDIQIGMEDKKGQLEVEVIRARSLTQKPGSKSTPAPYVKVYLLENGACIAKKKTRI
ARKTLDPLYQQSLVFDESPQGKVLQVIVWGDYGRMDHKCFMGVAQILLEELDLSSMVIGW
YKLFPPSSLVDPTLTPLTRRASQSSLESSSGPPCIRS
NT seq 4434 nt   +upstreamnt  +downstreamnt
atgtcctcggccgtggggccccgaggtcctcgcccacccacggtgcctccccctatgcaa
gaactgcccgacctgagccacctgaccgaggaggagaggaacattatcatggcagtgatg
gaccggcagaaggaagaggaggaaaaagaagaggccatgctcaagtgtgttgtcagggac
atggcgaagcctgctgcctgcaaaacaccaagaaatgctgaaagccagccccatcaacca
ccactgaacattttcagatgtgtctgtgttcccagaaagccaagcagcgaagagggaggc
ccagacagaaactggagattgcatcaacagtttgaaagctacaaggaacaagtgagaaaa
atcggagaggaagccaggcgttaccagggcgagcacaaagatgatgccccgacgtgtgga
atctgtcataagacaaagtttgctgatggatgtggccatctctgctcctattgtcgcacc
aagttctgtgcacgctgtggaggccgagtgtctctgcgatcgaacaatgaggacaaagtg
gttatgtgggtatgcaatttatgtcgaaagcaacaagagatattaacgaaatctggagcg
tggttcttcggaagtggtcctcagcagcccagtcaagatgggactctgagtgacacggct
acaggtgctggatctgaggtgccaagagaaaagaaagctcggctccaagagcgatcaagg
tctcagacgcccttgagtacagcagctgtctcttcccaagacactgcttcccatggtgca
ccactggacaggaacaaaggggcggagccctcacagcaagccttgggtcctgaacagaag
caggcatcaaggtcaagaagtgagccaccaagggaaaggaagaaggctccagggctttca
gagcagaatggcaagggaggccagaagagtgagcgcaaacgtgtccccaagtctgtggtg
caacccggggaagggaccgcggatgaacgggagaggaaggagaggcgggaaacccgcagg
ctggagaaagggcgctctcaggactacccggaccggctcgagaaacgcgaggatggcagg
gtggctgaagacgaaaagcagaggaaggaggaggagtatcagactaggtaccgcagcgac
ccgaacctggctcgctacccggtgaaggcgccgctggaggaacagcagatgcgcatgcac
gcccgggtgtcccgagcgaggcacgagcggcgccacagcgacgtggcgctcccgcacacc
gaggctgccgccgctgtgtcagccgagaccacggcgggcaagcgcgcgcagaccaccgcc
agggtctctcccccggagtccccgcgcgcacgcgcgcccgctgcccagcctcccgcggag
cacgggccgccgccgccgcggccagccccgggtccggcagagccgcccgaaccgcgcgtc
cccgagccgctccgtaagcagggccgcctggaccccggctcggctgtgctcctgcgcaag
gccaagcgcgagaaagcggaaagcatgctgcggaacgactcgctgagctccgatcagtcc
gagtcggtgcggccatccccgcccaagccacaccggcccaagcggggaggcaagaggcgt
cagatgtcggtgagcagctccgaggaggagggcgtgtccacgccggagtacacgagctgc
gaggacgtggagctggagagcgagagcgtgagcgagaaaggtgacttggactactggttg
gatcctgccacgtggcatagcagggaaacgtcgcctattagttcgcatcctgtaacgtgg
cagccatctaaagagggggaccgattaatcggccgtgttattcttaacaaaagaacaacc
atgcccaaagaatcaggtgcattattgggtctcaaggtggttggaggaaaaatgacggac
ttagggcgtcttggtgctttcatcaccaaagtaaagaagggtagcctggcagatgttgtc
ggacacctaagagcaggggatgaagttctagagtggaatggtaaacccctgccgggagca
acaaacgaagaagtttacaacattattttagaatcaaaatcagaacctcaagttgaaatt
attgtttcaaggcctattggtgacatccccaggatccctgagagttcccaccctcccctg
gagtccagttcaagttcctttgaatctcagaagatggaaaggccttccatttctgttatt
tctccaaccagccctggagctctgaaagatgccccacaagtcttaccagggcaactctca
gtgaagctgtggtatgataaggtggggcaccagctgattgtaaatgttctacaagcaaca
gatctaccccctagagtagatgggcgtcccagaaatccctatgtaaaaatgtattttctt
ccagatagaagcgacaagagtaaaagaagaaccaaaacggtaaagaaacttctagagcca
aaatggaatcaaacatttgtctactcacacgtacatcgtcgagattttcgagagcgaatg
ttagaaattactgtgtgggaccagccaagagtacaggacgaggagagtgaatttctagga
gagatcctcatagaattggaaacagcacttttagatgatgagccccattggtataaactg
cagacacatgatgaatcttcactacctctgcctcagccatcaccgttcatgcccaggcgg
catatccacggagaaagctccagcaaaaagctacaaagatctcagcgaatcagtgatagt
gacatctcagattatgaggttgatgatggtattggcgtagtgcctccagtgggttataga
gctagtgctagagagagtaaagccaccacgttaacagtgccagagcagcaaagaaccaca
catcaccgctcacgttccgtgtctcctcatcgcggcgatgatcagggaaggcctcgttca
cgtttaccaaatgtgccattacagaggagcttagatgaaatccatccaacacgaaggtca
cgttctccaacccgacaccatgatgcctcccgaagcctggccgatcacagatcacgacat
gcggaaagtcagtattcatcagagccagacagaacgcaccgacaaggaagccccacccag
tcacctccagctgacacatcctttggcagtcgccgcggaagacagctcccacaggtgccg
gtccgaagcggcagtatagaacaagcgagcttagtagtggaggaacgaacgagacagatg
aaaatgaaggtacaccgatttaagcagacaacagggtctgggtctagtcaagaacttgac
cacgagcaatactccaagtacaacatacataaagatcagtacagaagctgtgataacgcg
tccgccaagtcatcagatagtgatgtcagtgatgtgtccgccatttccagagccagcagc
acctcacgcctcagcagcacaagctttatgtcagagcagtctgagcgccccaggggcagg
atcagttcatttacccccaaaatgcaaggcagacggatggggacttcaggaagagccatc
atcaagagcaccagtgtaagtggagagatatatacactggagcacaatgacggcagccag
tccgacacggccgtgggtaccgttggagctggtggaaagaagcggaggtccagcctgagt
gccaaagtggtagccattgtgtctcgaagaagcagaagcacatcacagctcagccagaca
gagtccggccacaagaagttaaaaagcaccattcagaggagtacggaaacgggaatggcg
gctgaaatgcggaagatggtgagacagcccagccgggagtccacggatggcagcatcaac
agttatagctcagaaggaaacttaatatttcctggagttcgcgtgggacctgacagtcag
ttcagtgatttccttgatggattggggccagcccagcttgtcggccgccaaaccctcgcc
accccagccatgggcgatatccaaatcgggatggaggataagaagggtcagttggaggtt
gaggttatcagagcccggagccttacacaaaaacctggctccaaatctacacctgctccc
tatgtgaaagtttatcttttggaaaatggagcctgtattgccaaaaagaagacaagaatt
gcacggaaaactctcgatcccttgtatcagcagtccctggtttttgatgaaagtccacag
ggtaaagttcttcaggtgattgtctggggtgactatggaagaatggaccacaaatgcttt
atgggtgtggctcaaatcttgttggaagaacttgatctgtccagcatggtgattggatgg
tataaattgttccctccatcctccctggtggatcccacactcactcccctgacccgccgg
gcttcccaatcatcactggaaagttcgtctgggcctccctgcatccggtcatag

DBGET integrated database retrieval system