KEGG   Mus musculus (mouse): 117147
Entry
117147            CDS       T01002                                 

Gene name
Acsm1, Acas3, Bucs, Bucs1, Ma, Macs
Definition
(RefSeq) acyl-CoA synthetase medium-chain family member 1
  KO
K23756  medium-chain acyl-CoA ligase / lipoate-activating enzyme [EC:6.2.1.2]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00650  Butanoate metabolism
mmu00785  Lipoic acid metabolism
mmu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    117147 (Acsm1)
  09108 Metabolism of cofactors and vitamins
   00785 Lipoic acid metabolism
    117147 (Acsm1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:mmu01004]
    117147 (Acsm1)
Enzymes [BR:mmu01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.2  medium-chain acyl-CoA ligase
     117147 (Acsm1)
Lipid biosynthesis proteins [BR:mmu01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   117147 (Acsm1)
SSDB
Motif
Pfam: AMP-binding AMP-binding_C SRI
Other DBs
NCBI-GeneID: 117147
NCBI-ProteinID: NP_473435
MGI: 2152200
Ensembl: ENSMUSG00000033533
Vega: OTTMUSG00000023676
UniProt: Q91VA0
Position
7; 7 F2
AA seq 573 aa
MQWLKSFQICKVLQGFSLSPTQLHRRLFSRVGAPRWNDHDSPEEFNFASDVLDYWAQMEE
EGKRGPSPAFWWVNGQGDEIKWSFRKLRDLTCRTANVFEQICGLQQGDHLALILPRVPEW
WLVTVGCMRTGIIFMPGTTQLKAKDILYRIQISRAKAIVTTASLVPEVESVASECPDLKT
KLVVSDHSHEGWLDFCSLIKSASPDHTCIKSKMKDPMAIFFTSGTTGYPKMAKHNQGLAF
RSYIPSCRKLLKLKTSDILWCMSDPGWILATVGCLIEPWTSGCTVFIHHLPQFDPKVIVE
VLFKYPITQCLAAPGVYRMVLQQKTSNLRFPTLEHCTTGGESLLPEEYEQWKQRTGLSIH
EVYGQSETGISSATLREMKIKRGSIGKAILPFDLQIIDEKGNILPPNTEGYIGIRIKPTR
PLGLFMEYENSPESTSEVECGDFYNSGDRATIDEEGYIWFLGRGDDVINASGYRIGPVEV
ENALAEHPAVAESAVVSSPDKDRGEVVKAFIVLNPEFLSHDQEQLIKELQHHVKSVTAPY
KYPRKVEFVSELPKTVTGKIKRKELRNKEFGQL
NT seq 1722 nt   +upstreamnt  +downstreamnt
atgcagtggctgaagagtttccagatctgcaaagtcttacagggcttctccctaagcccc
acccagctgcacagacggttgttttcaagagttggagctccaagatggaatgaccatgat
tcacctgaggagtttaactttgcaagtgatgtcctggactactgggctcaaatggaggag
gagggcaagagaggaccaagtccagccttttggtgggtgaatggccaaggagatgaaata
aagtggagcttcaggaagctgagggacctcacctgtcgcactgccaacgtctttgagcag
atttgtggcctgcagcaaggagatcacctggccttgattctgccccgagtgcccgagtgg
tggttggtgacagtgggctgcatgcgaacagggatcatcttcatgcctgggactacccaa
ctgaaagccaaggacattctctaccgaatacaaatatctcgagccaaagccattgtgacc
acagctagccttgtcccagaggtggaatctgtggcttctgagtgtcctgatctgaaaacc
aagctggtggtgtctgatcacagccatgaagggtggcttgatttctgttcactgattaaa
tcagcatccccagaccatacttgtattaagtcaaagatgaaggatcccatggccatcttc
ttcaccagtgggaccacaggctaccccaagatggcaaagcacaaccagggacttgccttc
cggtcatatatcccttcatgcagaaaattattgaagctgaagacatctgacatcttgtgg
tgcatgtcagacccaggatggattctggctaccgtggggtgcctgatcgagccatggaca
tcaggatgtacagtcttcatccaccacctccctcaattcgaccccaaagtcattgtagag
gtactgttcaaataccccatcactcagtgccttgctgccccaggcgtgtatcgaatggtt
cttcagcagaaaacctccaacctcaggttccccacccttgagcattgcactactggtggg
gagagcctgctgcctgaggagtatgagcagtggaagcaaaggacaggtctttccatccac
gaggtctatggacagtcagaaacggggatcagcagtgccaccctccgggaaatgaagatc
aagcgaggctccatagggaaggccatcttaccctttgacttgcagatcatcgatgaaaag
ggcaacatcctcccacccaacactgaaggatacattggcatcaggatcaagcccaccagg
cctctaggcctcttcatggaatatgagaatagcccagagagcacatctgaagtggagtgt
ggggacttttacaatagtggggatagagcgaccattgatgaagagggctacatctggttc
ttgggaaggggcgatgatgtcatcaatgcttccgggtatcgcatcgggcctgtagaggtg
gagaacgccttggcggagcacccagcagtggcagagtctgcggtggtgagcagcccggac
aaggatcgaggagaggtggtgaaggcgtttattgtcctcaacccagagttcctgtcacac
gatcaggaacagcttatcaaagagctacagcatcatgtgaagtcagtgacggcaccatac
aagtaccccaggaaggtggagtttgtttcagaattgcccaaaactgtcacaggcaaaatc
aaaaggaaggaacttcgaaacaaggagtttggtcagctatga

KEGG   Mus musculus (mouse): 20216
Entry
20216             CDS       T01002                                 

Gene name
Acsm3, S, Sa, Sah
Definition
(RefSeq) acyl-CoA synthetase medium-chain family member 3
  KO
K01896  medium-chain acyl-CoA synthetase [EC:6.2.1.2]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00650  Butanoate metabolism
mmu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    20216 (Acsm3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:mmu01004]
    20216 (Acsm3)
Enzymes [BR:mmu01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.2  medium-chain acyl-CoA ligase
     20216 (Acsm3)
Lipid biosynthesis proteins [BR:mmu01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   20216 (Acsm3)
SSDB
Motif
Pfam: AMP-binding AMP-binding_C SH3_9
Other DBs
NCBI-GeneID: 20216
NCBI-ProteinID: NP_058566
MGI: 99538
Ensembl: ENSMUSG00000030935
Vega: OTTMUSG00000025655
UniProt: Q3UNX5
Position
7; 7 F2
AA seq 580 aa
MVMLLRARCFQRLAIPDPMRVLYKDYRTATPQNFSNYESMKQDFKIEIPEYFNFAKDVLD
QWTNMEKAGKRLSNPAFWWIDGNGEELRWSFEELGLLSRKFANILTEACSLQRGDRVMVI
LPKIPEWWLANVACLRTGTVLIPGTTQLTQKDILYRLQSSKAKCIITDDTLAPAVDAVAA
KCENLHSKLIVSQHSREGWGNLKEMMKYASDSHTCVDTKHDEMMAIYFTSGTTGPPKMIG
HTHSSFGLGLSVNGRFWLDLIASDVMWNTSDTGWAKSAWSSVFSPWTQGACVFAHYLPRF
ESTSILQTLSKFPITVFCSAPTAYRMLVQNDMSSYKFNSLKHCVSAGEPINPEVMEQWRK
KTGLDIYEGYGQTETVLICGNFKGMKIKPGSMGKPSPAFDVKILDENGATLPPGQEGDIA
LQVLPERPFGLFTHYVDNPSKTASTLRGSFYITGDRGYMDEDGYFWFVARSDDIILSSGY
RIGPFEVESALIEHPSIAESAVVSSPDPIRGEVVKAFIVLNPDYKSHDQEQLKKEIQEHV
KKTTAPYKYPRKVEFIEELPKTVSGKVKRNELRKKEWVTT
NT seq 1743 nt   +upstreamnt  +downstreamnt
atggtgatgttactccgtgctaggtgttttcagcgcctagcaattcctgatcctatgaga
gtcttgtataaagattacagaacagcgacccctcagaacttttccaactatgagtccatg
aaacaagacttcaaaatagagattccagagtatttcaattttgcaaaagatgtcctggac
caatggaccaatatggaaaaggctggaaagagactttccaatccagccttctggtggata
gatgggaatggagaagagctgagatggagttttgaagaacttgggttgttatccaggaaa
tttgccaacatactcacagaagcctgctccctgcaaagaggagacagagtaatggtgata
ctgcccaagatcccagagtggtggcttgcaaatgtggcctgtctgcgaacagggacagtt
ttaattccaggaaccactcagctgacccagaaagacatcctctatagactacaatcttca
aaagctaagtgcattattaccgatgatactttggccccagcagtagatgccgtggcagct
aaatgtgaaaatctccactccaaattaattgtgtctcagcactccagagaaggctggggg
aacctcaaggagatgatgaaatatgccagtgacagccacacttgtgtggacacaaaacac
gacgagatgatggccatctacttcaccagtgggacaactgggcctcctaagatgattgga
cacacccacagcagctttggtttaggattgtctgtcaatggaaggttctggctggatttg
atagcctccgatgtgatgtggaatacttcagatacaggctgggcaaagtctgcatggagt
agtgttttttctccatggacccaaggagcatgtgtttttgcacactatttgccccgtttt
gaatcaacttccatcttgcaaaccctctccaagttccccatcactgtcttctgttctgca
ccaactgcctaccggatgcttgttcagaatgacatgagcagctataagttcaacagtttg
aagcactgtgtcagtgctggagaacctattaaccctgaagtgatggaacaatggagaaag
aagacgggcctagacatctatgaaggatatggacagacagaaacggtgctgatctgtgga
aatttcaaggggatgaaaattaagcccggctcaatgggaaagccttctcctgcttttgat
gtgaagattttagatgaaaatggtgccactcttcctcctggacaagaaggggatattgct
cttcaagttcttcctgagcgaccatttggcctttttactcattatgtagataatccttcc
aaaacggcttcaactctacgagggagtttctacattactggggacagaggatatatggat
gaagatggctatttctggtttgttgcaagatcagatgatatcatattatcttctggttac
cgaattggaccatttgaggtagaaagtgccctcatagaacatccttccatcgcagagtca
gctgttgtcagcagtccagaccccatcagaggagaggtagtaaaggcttttattgtcctg
aatcctgattacaagtcccatgatcaagagcaactgaaaaaggagatccaggagcacgtg
aagaagactacagcgccttacaaataccccagaaaggtagaatttattgaagagctgccg
aagactgtcagtgggaaggtcaaaagaaatgaactgaggaaaaaggaatgggtaacaact
tga

KEGG   Mus musculus (mouse): 233799
Entry
233799            CDS       T01002                                 

Gene name
Acsm2, AI315615, BC031140
Definition
(RefSeq) acyl-CoA synthetase medium-chain family member 2
  KO
K01896  medium-chain acyl-CoA synthetase [EC:6.2.1.2]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00650  Butanoate metabolism
mmu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    233799 (Acsm2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:mmu01004]
    233799 (Acsm2)
Enzymes [BR:mmu01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.2  medium-chain acyl-CoA ligase
     233799 (Acsm2)
Lipid biosynthesis proteins [BR:mmu01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   233799 (Acsm2)
SSDB
Motif
Pfam: AMP-binding AMP-binding_C
Other DBs
NCBI-GeneID: 233799
NCBI-ProteinID: NP_666309
MGI: 2385289
Ensembl: ENSMUSG00000030945
Vega: OTTMUSG00000027306
UniProt: Q8K0L3
Position
7; 7 F2
AA seq 575 aa
MHHLWKIPRLFTLWGNEISCRTFHMNIKKLIPIQWGHQEAPAKFNFASDVIDHWASVEKA
GKRSSGPALWWMNGSGKEIKWSFRELSEASKQTANVLSGACGLHRGDRVAVVLPRIPEWW
LMILGCMRTGLVFMPGTIQMRSSDILYRLQASKARAIVAGDEVAQEVDAVAPDCSFLKIK
LLVSENSREGWLNFKALLKEASTIHQCVETESRESAAIYFTSGTSGPPKMAEHSHCSLGI
KAKMDAASWTGLSTSDIIWTISDTAWIMNILGAFLEPWVLGACIFVHLLPKFDSQTVLKV
LSSYPINTLVGAPIIYRMLLQQDLSSYKFPHLHSCFSGGETLLPETLENWKAKTGLEIRE
IYGQTETGLICRVSRTMKVKPGYLGTAFAHYDVQVIDEQGNVLPPGKEGDIAIRVKPIWP
IGMFSGYVDNPKKTQDNIRGDFWLMGDRGIKDPEGYFHFIGRSDDIINSSGYRIGPSEVE
NALMEHPAVSETAVISSPDPSRGEVVKAFVVLAPEFLSHDRDQLTKVLQEHVKSVTAPYK
YPRKVEFVLDLPKTVTGKIERAKLRAKEWKTSGRA
NT seq 1728 nt   +upstreamnt  +downstreamnt
atgcatcatctatggaaaattccaagacttttcactctctgggggaatgagatttcctgc
cgtactttccatatgaatatcaagaaactaatacccatacagtggggccaccaggaagca
cctgccaagttcaacttcgctagtgatgtgatagatcactgggccagcgtagagaaggct
ggcaagagatcttcaggtccagccctgtggtggatgaatggcagtgggaaagaaataaag
tggagcttccgagaactgagtgaagccagtaaacaaacggccaatgttctctcgggagcc
tgtggcctacatcgtggggaccgtgtggcagtagtgcttccccgaatcccagagtggtgg
ctgatgatcctgggctgcatgcggacaggccttgttttcatgcctgggaccatccagatg
agatcctcagacatactctacaggctgcaggcatccaaggccagggccattgtggctggg
gacgaagtagctcaggaagtggatgctgtggcccctgactgctcttttctgaaaatcaag
ttgctggtgtctgaaaacagtcgagaaggatggctaaacttcaaggcattgctaaaagag
gcatccaccattcatcagtgtgtggagacagaaagccgagaatcagcagccatctacttc
actagtgggaccagtggccctcccaagatggcagaacactcccactgcagcctgggcatc
aaggccaagatggatgctgccagctggacaggcctgagtacttctgacataatatggacc
atctcagacacggcttggataatgaacattttaggagcgtttctggaaccttgggtattg
ggagcatgcatatttgtccatcttttgccaaagtttgattcacaaactgttctaaaggtg
ctttccagctatcccatcaataccctggtgggtgcccccatcatttaccggatgttgcta
caacaggatctttccagttacaaatttccacatctgcatagctgcttcagtggaggagag
acccttctcccagagactctggagaactggaaagccaagacaggactggaaatccgagaa
atctatggccagacagaaacgggacttatctgcagagtttccaggacaatgaaagtcaaa
ccaggctacctgggaacagcctttgctcactatgatgtacaggtcatagatgagcagggc
aatgttctgccccctggcaaggaaggagacatagctatcagggtgaagcccatctggcct
atcggcatgttctctggatatgtggacaatcccaagaagacacaggataatattcgagga
gacttttggcttatgggagaccggggaatcaaggatccagaagggtatttccacttcata
gggcggtcagacgatatcattaattccagtgggtaccggattggaccttccgaggtggaa
aatgcactgatggagcatcctgccgtaagcgaaacagcagtgatcagcagcccagaccct
tccagaggagaggtggtgaaggcatttgtggtcctagcccctgaattcctgtcccatgac
cgagaccagctcactaaggtgcttcaggagcacgtgaagtcagtgacagcaccctacaag
taccccaggaaggtggagttcgtcttagacctgcccaagaccgtcacaggaaaaattgag
cgagcaaagcttcgagccaaggaatggaaaacatcaggacgagcctag

KEGG   Mus musculus (mouse): 233801
Entry
233801            CDS       T01002                                 

Gene name
Acsm4, O-M, O-MACS, OM, OMACS
Definition
(RefSeq) acyl-CoA synthetase medium-chain family member 4
  KO
K01896  medium-chain acyl-CoA synthetase [EC:6.2.1.2]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00650  Butanoate metabolism
mmu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    233801 (Acsm4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:mmu01004]
    233801 (Acsm4)
Enzymes [BR:mmu01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.2  medium-chain acyl-CoA ligase
     233801 (Acsm4)
Lipid biosynthesis proteins [BR:mmu01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   233801 (Acsm4)
SSDB
Motif
Pfam: AMP-binding AMP-binding_C UFC1
Other DBs
NCBI-GeneID: 233801
NCBI-ProteinID: NP_848501
MGI: 2681844
Ensembl: ENSMUSG00000047026
Vega: OTTMUSG00000023914
UniProt: Q80W40
Position
7; 7 F2
AA seq 580 aa
MKVLLHCQRLRFIWLAKPAGRHFHRDSQLWAPLTLDDFEAINRCEKPLPKNFNFAADVLD
QWSLKEKSGERPANPALWWVNGKGDEVKWSFQELGSLSRKAANVLTKPCGLQRGDRVAVI
LPRIPEWWLINVACMRTGLVFMPGTIQLTRKDILYRLQASKAKCIVASEEVAPAVDSIVS
ECPSLKTKLLVSPHHWDGWLNFQELLQSASEEHNCVETGSQEPMAIYFTSGTTGSPKMAQ
HSQGSLGIGYTLCGRYWLDLTSSDIMWNMSDTGWIKAAIGSVFSTWLRGACVFVHRMAQF
DTDIFLDTLTTYPITTLCSAPTVYRMLVQKDLKRYQFKRLRHCLTGGEPLNPEVLEQWKM
QTGLELYEGYGQTEVGIICANRKGEAIKPGSMGKGVVPYDVQIIDENGNILPSGKEGEIA
LRLKSDRPFCFFSEYVDNPEKTDATIRRNFYVTGDRGVMDDDGYFWFVGRADDVIISSGY
RIGPFEVESALIEHPAVVESAVVSSPDPIRGEVVKAFIVLAAPYKCSNREKLTAELQDHV
KNSTAPYKYPRKVEFVQELPKTITGKIKRNVLRDQEWGRA
NT seq 1743 nt   +upstreamnt  +downstreamnt
atgaaggttctcctccactgtcagagacttagattcatctggcttgccaagccagccggc
cggcacttccacagagattcccagctctgggcacctctgacactggatgactttgaagcc
atcaatcgctgtgagaagccattacccaagaactttaactttgcagcagatgttctggac
cagtggtccctaaaggagaagtctggagagaggccagccaacccagccctgtggtgggtg
aatgggaaaggagatgaggtgaagtggagcttccaagaactgggttccttgtcccgaaag
gctgccaatgtgctcaccaagccctgcggcctgcagagaggagaccgggtggctgtgatt
ctgccccgtatccctgaatggtggctcatcaatgtggcttgcatgagaacagggcttgta
ttcatgccaggaacgatccaactgaccagaaaagacatcctctaccggctgcaagcatcc
aaggccaagtgcattgtggctagtgaggaagtggcccccgcagtggactccattgtatca
gagtgtcccagcctgaagactaaactcctggtgtctccacaccactgggatggatggctc
aactttcaggagttacttcaatcggcctctgaagagcacaattgtgtggagacgggaagt
caagaaccaatggccatttacttcaccagtgggaccacaggctcccccaagatggctcag
cactcacagggcagccttggcattgggtataccctttgtggaaggtactggctggacttg
acatcctcagatatcatgtggaacatgtcagacactggctggatcaaggctgccattggt
agtgtgttttctacatggcttcgaggggcctgtgtttttgtgcaccggatggcccagttc
gacactgatatcttcctagacacacttaccacatatcccatcacgaccctgtgcagtgct
cctacggtgtaccggatgctcgtacaaaaggaccttaagagatatcaattcaagaggctg
cggcactgcctgacaggaggggagccactcaaccccgaagtgctggaacagtggaagatg
caaactgggctggagctgtacgagggctacggacagaccgaagtgggaataatttgcgcc
aatcgcaaaggagaagcaattaaaccaggttccatgggaaaaggagtagtgccgtacgat
gtgcagattatagatgaaaatggaaatatcctaccatccggcaaggaaggggaaattgcc
cttaggctgaagtccgatcggcccttctgtttcttctctgaatatgtggacaatccagaa
aagacagatgccacaataagaagaaatttttatgtcactggagacagaggagtgatggat
gatgacggatacttttggtttgtcggcagagctgatgatgtcattatatcttctgggtac
cgaattgggccttttgaagtagagagcgcactgatagagcacccagcagtagttgagtca
gctgttgtcagcagtccagatccgatccgaggagaggtggtgaaggcatttattgtacta
gctgcaccctacaagtgctccaaccgtgagaagttaaccgctgaacttcaggatcatgtg
aaaaattcaacagcaccttacaaatacccaagaaaagtggaatttgttcaagaactccca
aagacaatcactgggaaaatcaaacgcaacgtgttaagagaccaggaatggggaagagca
tag

KEGG   Mus musculus (mouse): 272428
Entry
272428            CDS       T01002                                 

Gene name
Acsm5, C730019D22, C730027J19Rik
Definition
(RefSeq) acyl-CoA synthetase medium-chain family member 5
  KO
K01896  medium-chain acyl-CoA synthetase [EC:6.2.1.2]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00650  Butanoate metabolism
mmu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    272428 (Acsm5)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:mmu01004]
    272428 (Acsm5)
Enzymes [BR:mmu01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.2  medium-chain acyl-CoA ligase
     272428 (Acsm5)
Lipid biosynthesis proteins [BR:mmu01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   272428 (Acsm5)
SSDB
Motif
Pfam: AMP-binding AMP-binding_C
Other DBs
NCBI-GeneID: 272428
NCBI-ProteinID: NP_848873
MGI: 2444086
Ensembl: ENSMUSG00000030972
Vega: OTTMUSG00000059117
UniProt: Q8BGA8
Position
7; 7 F2
AA seq 578 aa
MRLWLRGLACQALRSSWGVCRIHTQPPPPPIPEVVATWEAISLGRQPVPEYFNFAHDVLD
VWSQLEKTGHRPPNPAFWWVNGSGTEVKWTFEELGKQSRKAANVLEGVCGLQPGDRMMLV
LPRLPDWWLISVACMRTGVVMIPGVSQLTAKDLKYRLQAARAKSIVTSDALAPQVDAISA
DCPSLQTKLLVSDTSRPGWINFRELLRAASPEHNCVRTRSGDSVAIYFTSGTTGAPKMVE
HSQSSYGLGFVASGRRWMALTESDIFWNTTDTGWVKAAWTLFSAWSNGACIFVHELPRVD
AKTILNTLCRFPITTLCCVPTLFRLLVQEDLTRYKFQCLRHCLTGGEALNPDVRDKWKSQ
TGLELHEGYGQSETVVICGNSRNSTIKSGSMGKASPPYDVQIVDEEGNVLPPGKEGNIAV
RIKPTRPFCFFNCYLDNPEKTAASEQGDFYITGDRAHMDEDGYFWFLGRNDDVINSSSYR
IGPVEVESALAEHPAVLESAVVSSPDPIRGEVVKAFIVLSPAYASHDPEALTRELQEHVK
TVTAPYKYPRKVAFISELPKTVSGKILRSKLRNQEWGR
NT seq 1737 nt   +upstreamnt  +downstreamnt
atgaggttgtggctaagaggcctggcctgccaggctctgaggagttcctggggagtctgc
aggattcacacacagccaccacctcccccgatccctgaggtggtagctacctgggaagcc
atcagcctggggaggcagccagtgcccgagtacttcaactttgctcatgatgtgttggat
gtgtggagtcagctggaaaagacagggcaccggcccccaaatcctgcattctggtgggtg
aacggctcaggaacagaagtcaagtggacatttgaggagctggggaagcagtcgaggaag
gcagccaatgtcttagagggtgtgtgtggcctgcaacctggagacagaatgatgctggtg
cttccgagactcccagattggtggctgatcagcgtggcttgtatgcgaacaggtgtggtc
atgatcccaggagtctcccagctgacagcgaaggatctcaagtatcggctgcaggctgcc
agggccaagtctatcgtcaccagtgatgccctagctccgcaagtggatgccatcagtgct
gactgtccctccctccaaaccaagcttctggtgtctgacaccagccgtccaggctggatc
aatttccgagaactcctgagagcggcttctccagagcacaactgtgtgagaaccagaagt
ggagattcagtggccatctacttcaccagtggaaccacaggggcccccaagatggtggaa
cattcccagtccagctatggattgggttttgtggccagtggaaggaggtggatggccttg
actgagtctgacatattctggaacacaactgacactggatgggtgaaagcagcctggacc
ctcttctctgcctggtccaatggagcttgcatttttgtgcatgagctgccccgagttgat
gccaaaactattctaaatactctctgcaggttcccaataaccaccctgtgctgtgtccca
accctcttccggctgcttgtacaagaggatctgacaaggtacaagttccaatgtctgagg
cactgtttgacgggtggagaggccctcaaccctgatgtgagggacaagtggaagagccag
acaggcctggagctccatgaaggctatggacaatcagaaacagttgtcatctgtggcaat
tcaagaaactcgacaatcaagtctggatctatggggaaagcaagcccaccttacgatgtg
cagattgtagatgaggagggcaatgtcctgcctccaggaaaagagggaaatattgctgtc
cgaatcaagcctactagacccttctgtttcttcaactgctatctggacaatcccgagaag
acagcagcatcagagcaaggagacttttacatcactggggacagagcacatatggacgag
gatggctacttttggttcttggggagaaatgatgatgtaatcaactcttcaagctaccgg
attggtcctgttgaagtagagagtgcacttgctgagcatccagctgtcctggagtctgct
gtggtcagcagcccagaccccatccggggagaggtggtaaaggcatttatagtcctttct
ccagcctatgcatctcatgacccagaagccctgaccagggaactccaggagcatgtgaag
acagtgactgctccatacaagtaccccaggaaggtggcttttatttcagaactgccaaag
acggtttctggaaagatcctaaggagtaaattgagaaaccaagagtgggggagatga

DBGET integrated database retrieval system