KEGG   Mus musculus (mouse): 11928
Entry
11928             CDS       T01002                                 

Symbol
Atp1a1, Atpa-1, BC010319
Name
(RefSeq) ATPase, Na+/K+ transporting, alpha 1 polypeptide
  KO
K01539  sodium/potassium-transporting ATPase subunit alpha [EC:7.2.2.13]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04022  cGMP-PKG signaling pathway
mmu04024  cAMP signaling pathway
mmu04260  Cardiac muscle contraction
mmu04261  Adrenergic signaling in cardiomyocytes
mmu04911  Insulin secretion
mmu04918  Thyroid hormone synthesis
mmu04919  Thyroid hormone signaling pathway
mmu04925  Aldosterone synthesis and secretion
mmu04960  Aldosterone-regulated sodium reabsorption
mmu04961  Endocrine and other factor-regulated calcium reabsorption
mmu04964  Proximal tubule bicarbonate reclamation
mmu04970  Salivary secretion
mmu04971  Gastric acid secretion
mmu04972  Pancreatic secretion
mmu04973  Carbohydrate digestion and absorption
mmu04974  Protein digestion and absorption
mmu04976  Bile secretion
mmu04978  Mineral absorption
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    11928 (Atp1a1)
   04022 cGMP-PKG signaling pathway
    11928 (Atp1a1)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    11928 (Atp1a1)
   04918 Thyroid hormone synthesis
    11928 (Atp1a1)
   04919 Thyroid hormone signaling pathway
    11928 (Atp1a1)
   04925 Aldosterone synthesis and secretion
    11928 (Atp1a1)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    11928 (Atp1a1)
   04261 Adrenergic signaling in cardiomyocytes
    11928 (Atp1a1)
  09154 Digestive system
   04970 Salivary secretion
    11928 (Atp1a1)
   04971 Gastric acid secretion
    11928 (Atp1a1)
   04972 Pancreatic secretion
    11928 (Atp1a1)
   04976 Bile secretion
    11928 (Atp1a1)
   04973 Carbohydrate digestion and absorption
    11928 (Atp1a1)
   04974 Protein digestion and absorption
    11928 (Atp1a1)
   04978 Mineral absorption
    11928 (Atp1a1)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    11928 (Atp1a1)
   04961 Endocrine and other factor-regulated calcium reabsorption
    11928 (Atp1a1)
   04964 Proximal tubule bicarbonate reclamation
    11928 (Atp1a1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    11928 (Atp1a1)
Enzymes [BR:mmu01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.2.2.13  Na+/K+-exchanging ATPase
     11928 (Atp1a1)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   11928 (Atp1a1)
  Exosomal proteins of other body fluids (saliva and urine)
   11928 (Atp1a1)
  Exosomal proteins of colorectal cancer cells
   11928 (Atp1a1)
  Exosomal proteins of bladder cancer cells
   11928 (Atp1a1)
SSDB
Motif
Pfam: E1-E2_ATPase Cation_ATPase_C Cation_ATPase Hydrolase Cation_ATPase_N Hydrolase_3
Other DBs
NCBI-GeneID: 11928
NCBI-ProteinID: NP_659149
MGI: 88105
Ensembl: ENSMUSG00000033161
Vega: OTTMUSG00000016447
UniProt: Q8VDN2
Position
3 F2.2; 3 44.3 cM
AA seq 1023 aa
MGKGVGRDKYEPAAVSEHGDKKGKKAKKERDMDELKKEVSMDDHKLSLDELHRKYGTDLS
RGLTPARAAEILARDGPNALTPPPTTPEWVKFCRQLFGGFSMLLWIGAILCFLAYGIRSA
TEEEPPNDDLYLGVVLSAVVIITGCFSYYQEAKSSKIMESFKNMVPQQALVIRNGEKMSI
NAEDVVVGDLVEVKGGDRIPADLRIISANGCKVDNSSLTGESEPQTRSPDFTNENPLETR
NIAFFSTNCVEGTARGIVVYTGDRTVMGRIATLASGLEGGQTPIAEEIEHFIHLITGVAV
FLGVSFFILSLILEYTWLEAVIFLIGIIVANVPEGLLATVTVCLTLTAKRMARKNCLVKN
LEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNQIHEADTTENQSGVSFDKTSATWFA
LSRIAGLCNRAVFQANQENLPILKRAVAGDASESALLKCIEVCCGSVMEMREKYSKIVEI
PFNSTNKYQLSIHKNPNASEPKHLLVMKGAPERILDRCSSILLHGKEQPLDEELKDAFQN
AYLELGGLGERVLGFCHLLLPDEQFPEGFQFDTDDVNFPVDNLCFVGLISMIDPPRAAVP
DAVGKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGNETVEDIAARLNIPVNQVNPRDA
KACVVHGSDLKDMTSEELDDILRYHTEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVN
DSPALKKADIGVAMGIVGSDVSKQAADMILLDDNFASIVTGVEEGRLIFDNLKKSIAYTL
TSNIPEITPFLIFIIANIPLPLGTVTILCIDLGTDMVPAISLAYEQAESDIMKRQPRNPK
TDKLVNERLISMAYGQIGMIQALGGFFTYFVILAENGFLPFHLLGIRETWDDRWVNDVED
SYGQQWTYEQRKIVEFTCHTAFFVSIVVVQWADLVICKTRRNSVFQQGMKNKILIFGLFE
ETALAAFLSYCPGMGAALRMYPLKPTWWFCAFPYSLLIFVYDEVRKLIIRRRPGGWVEKE
TYY
NT seq 3072 nt   +upstreamnt  +downstreamnt
atggggaagggggttggacgagacaagtatgagcctgccgctgtatcggagcatggtgac
aaaaagggcaaaaaggccaagaaggaaagggatatggatgagctcaagaaggaagtgtct
atggacgaccataaactcagcctggatgaactccatcgtaaatacggaacagatttgagc
cgaggattaacacctgcaagggccgctgagatcctggcccgggatggccccaacgccctc
acaccccctcccactactcccgaatgggtgaaattctgccggcagctctttggaggcttt
tccatgttactgtggatcggggccattctttgtttcctggcttatggcatccgaagtgct
acagaagaggaaccgccaaacgatgatctgtacctcggggtggtgctctctgctgtagtc
atcataactggctgtttctcctattatcaagaagcaaaaagctccaagatcatggaatcc
ttcaagaacatggtccctcagcaagcccttgtgattcgaaatggagagaaaatgagcatc
aatgcggaggatgtcgtcgtcggggatctggtggaggtgaaagggggagaccggatccct
gctgatcttagaatcatatctgcaaacggctgcaaggtggataactcctcactcactggt
gaatcagaaccccagactcggtccccggatttcacaaacgagaaccccttggagacaagg
aacattgccttcttctcaaccaactgtgtggaaggaaccgcacgtggcatcgtcgtgtac
actggggaccgcaccgtgatgggcaggattgccacgcttgcctctgggctagaaggtggc
cagacccccattgctgaagagattgagcatttcatccacctcatcaccggggtggccgtg
ttcctgggggtgtctttcttcatcctttctctgatccttgagtacacctggctcgaggct
gtcatcttcctcattggtatcatcgtagccaacgtgccagaaggtctgctggccactgtc
acggtctgtctgacactcactgccaagcgcatggcgaggaagaactgcctggtgaagaac
ttggaagctgtggagaccttggggtccacatctaccatctgctcagacaagacgggaact
ctgactcagaaccggatgacagtggcccacatgtggtttgacaatcagatccatgaagct
gacaccacggagaatcagagtggtgtctcctttgacaagacgtcagccacctggttcgct
ctgtccagaattgctggtctctgtaacagggcagtgtttcaggctaaccaagaaaacctg
cctattcttaagcgggcagtagcgggagatgcctctgagtcggcgctcttaaagtgcatt
gaagtctgctgcggctccgtgatggagatgagggagaaatacagcaagatagtggagatt
cccttcaactccaccaacaagtaccagttgtccattcacaagaacccaaatgcatctgag
cccaaacacctgctagtgatgaagggcgccccagaaaggatcctggaccgctgcagctcc
atccttctccacggcaaggagcagccactggatgaagagctgaaggacgcttttcagaac
gcctacctagagctggggggccttggagaacgtgtgctaggtttctgccacctcctcctg
cctgacgaacagtttcccgaaggcttccagtttgacactgacgatgtcaatttccccgtg
gataacctctgcttcgtgggtcttatctccatgattgaccctccccgagctgctgtcccc
gatgctgtgggcaaatgccgcagcgctgggattaaggtcatcatggttacaggagaccat
ccaatcacagcgaaagccattgccaagggggtaggcattatctcagaaggcaatgagact
gtggaagacattgctgcccgcctcaacattccagtgaaccaggtgaaccccagagatgcc
aaggcctgtgtggtccacggcagtgacctgaaggacatgacctccgaggagctggatgac
atcttgcggtaccacacagagatcgtctttgccaggacctctcctcagcagaagctcatc
attgtggagggctgccagcggcagggcgccatcgtggccgtcacaggggatggtgtcaat
gactctccagctttgaaaaaggcagatattggggttgccatggggattgttggctctgat
gtgtccaagcaagctgctgacatgatccttctggatgacaactttgcctccattgtgact
ggagtagaggaaggtcgtctgatttttgataacttgaagaaatccatcgcttacacccta
accagtaacattccggaaatcacccccttcttgatatttattattgcaaacattccactg
cccctggggactgtgaccatcctctgcattgacttgggcactgacatggttcctgccatc
tccctggcctacgagcaagctgagagcgacatcatgaagaggcagcccagaaaccccaaa
acggacaaacttgtgaacgagcgtctgatcagcatggcctatggacagatcggtatgatc
caggccctgggaggcttcttcacttactttgtgattctggctgagaacggtttcctgccc
tttcacctgttgggcatccgagagacctgggatgaccgctgggtcaacgatgtggaggac
agctacgggcagcagtggacctacgagcagaggaagatcgtggagttcacctgccataca
gcgttctttgtcagtattgtggtagtgcagtgggccgacttggtcatctgcaagaccaga
aggaattctgtcttccagcagggaatgaagaacaagatcttgatatttggcctctttgaa
gagacagcccttgctgctttcttatcctactgccccgggatgggggcagcccttaggatg
tatcccctcaaacctacatggtggttctgtgccttcccctactcccttctcatctttgtg
tatgacgaggtgcggaagctcattatcaggcggcgccctggcggctgggtggagaaggaa
acctactactag

KEGG   Mus musculus (mouse): 11931
Entry
11931             CDS       T01002                                 

Symbol
Atp1b1, Atp4b, Atpb, Atpb-1, NKbeta1
Name
(RefSeq) ATPase, Na+/K+ transporting, beta 1 polypeptide
  KO
K01540  sodium/potassium-transporting ATPase subunit beta
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04022  cGMP-PKG signaling pathway
mmu04024  cAMP signaling pathway
mmu04260  Cardiac muscle contraction
mmu04261  Adrenergic signaling in cardiomyocytes
mmu04911  Insulin secretion
mmu04918  Thyroid hormone synthesis
mmu04919  Thyroid hormone signaling pathway
mmu04925  Aldosterone synthesis and secretion
mmu04960  Aldosterone-regulated sodium reabsorption
mmu04961  Endocrine and other factor-regulated calcium reabsorption
mmu04964  Proximal tubule bicarbonate reclamation
mmu04970  Salivary secretion
mmu04971  Gastric acid secretion
mmu04972  Pancreatic secretion
mmu04973  Carbohydrate digestion and absorption
mmu04974  Protein digestion and absorption
mmu04976  Bile secretion
mmu04978  Mineral absorption
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    11931 (Atp1b1)
   04022 cGMP-PKG signaling pathway
    11931 (Atp1b1)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    11931 (Atp1b1)
   04918 Thyroid hormone synthesis
    11931 (Atp1b1)
   04919 Thyroid hormone signaling pathway
    11931 (Atp1b1)
   04925 Aldosterone synthesis and secretion
    11931 (Atp1b1)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    11931 (Atp1b1)
   04261 Adrenergic signaling in cardiomyocytes
    11931 (Atp1b1)
  09154 Digestive system
   04970 Salivary secretion
    11931 (Atp1b1)
   04971 Gastric acid secretion
    11931 (Atp1b1)
   04972 Pancreatic secretion
    11931 (Atp1b1)
   04976 Bile secretion
    11931 (Atp1b1)
   04973 Carbohydrate digestion and absorption
    11931 (Atp1b1)
   04974 Protein digestion and absorption
    11931 (Atp1b1)
   04978 Mineral absorption
    11931 (Atp1b1)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    11931 (Atp1b1)
   04961 Endocrine and other factor-regulated calcium reabsorption
    11931 (Atp1b1)
   04964 Proximal tubule bicarbonate reclamation
    11931 (Atp1b1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mmu04090]
    11931 (Atp1b1)
CD molecules [BR:mmu04090]
 Proteins
  11931 (Atp1b1)
SSDB
Motif
Pfam: Na_K-ATPase
Other DBs
NCBI-GeneID: 11931
NCBI-ProteinID: NP_033851
MGI: 88108
Ensembl: ENSMUSG00000026576
Vega: OTTMUSG00000049860
UniProt: P14094 Q545P0 Q3TV47
Position
1 H2.2; 1 71.75 cM
AA seq 304 aa
MARGKAKEEGSWKKFIWNSEKKEFLGRTGGSWFKILLFYVIFYGCLAGIFIGTIQVMLLT
ISELKPTYQDRVAPPGLTQIPQIQKTEISFRPNDPKSYEAYVLNIIRFLEKYKDSAQKDD
MIFEDCGNVPSEPKERGDINHERGERKVCRFKLDWLGNCSGLNDDSYGYREGKPCIIIKL
NRVLGFKPKPPKNESLETYPLMMKYNPNVLPVQCTGKRDEDKDKVGNIEYFGMGGYYGFP
LQYYPYYGKLLQPKYLQPLLAVQFTNLTVDTEIRVECKAYGENIGYSEKDRFQGRFDVKI
EIKS
NT seq 915 nt   +upstreamnt  +downstreamnt
atggcccgcggaaaagccaaggaggaaggcagctggaagaaattcatctggaactcggag
aagaaggagtttttgggcaggaccggtggtagttggtttaagatccttctgttctacgtg
atattttatggctgcctggctggcatcttcatcgggaccatccaagtaatgctgctaacc
atcagtgaactgaagcccacataccaggaccgagtggccccgccaggattgacacagatt
ccccagatccagaagactgagatctccttccgtcctaatgaccccaagagctacgaggcc
tacgtgctaaacatcatcaggttcctggaaaagtacaaggattcagcccagaaggacgac
atgattttcgaggactgtggcaatgttcccagtgaacccaaggaacggggcgacatcaat
cacgaacgaggagagaggaaggtgtgcaggttcaagcttgactggctggggaactgctcc
ggtctcaatgatgactcttacggctacagagaggggaagccctgcatcattatcaagctc
aaccgagtgttgggcttcaaaccgaagcctcccaagaatgaatccttggagacttaccca
ctgatgatgaagtataatccaaatgtcctgcctgttcagtgcactggcaagagagatgaa
gataaggataaagtcgggaacatagagtactttgggatgggcggatactacggcttccct
ctgcagtattatccctactacggcaaactcctgcagcccaagtacctgcagcccctgctg
gccgtgcagttcaccaacctcaccgtggacactgaaatccgcgtcgagtgtaaggcgtat
ggtgagaacattgggtacagtgagaaagaccgttttcagggacgctttgatgtaaaaatt
gaaattaagagctga

KEGG   Mus musculus (mouse): 11932
Entry
11932             CDS       T01002                                 

Symbol
Atp1b2, Amog, Atpb-2
Name
(RefSeq) ATPase, Na+/K+ transporting, beta 2 polypeptide
  KO
K01540  sodium/potassium-transporting ATPase subunit beta
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04022  cGMP-PKG signaling pathway
mmu04024  cAMP signaling pathway
mmu04260  Cardiac muscle contraction
mmu04261  Adrenergic signaling in cardiomyocytes
mmu04911  Insulin secretion
mmu04918  Thyroid hormone synthesis
mmu04919  Thyroid hormone signaling pathway
mmu04925  Aldosterone synthesis and secretion
mmu04960  Aldosterone-regulated sodium reabsorption
mmu04961  Endocrine and other factor-regulated calcium reabsorption
mmu04964  Proximal tubule bicarbonate reclamation
mmu04970  Salivary secretion
mmu04971  Gastric acid secretion
mmu04972  Pancreatic secretion
mmu04973  Carbohydrate digestion and absorption
mmu04974  Protein digestion and absorption
mmu04976  Bile secretion
mmu04978  Mineral absorption
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    11932 (Atp1b2)
   04022 cGMP-PKG signaling pathway
    11932 (Atp1b2)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    11932 (Atp1b2)
   04918 Thyroid hormone synthesis
    11932 (Atp1b2)
   04919 Thyroid hormone signaling pathway
    11932 (Atp1b2)
   04925 Aldosterone synthesis and secretion
    11932 (Atp1b2)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    11932 (Atp1b2)
   04261 Adrenergic signaling in cardiomyocytes
    11932 (Atp1b2)
  09154 Digestive system
   04970 Salivary secretion
    11932 (Atp1b2)
   04971 Gastric acid secretion
    11932 (Atp1b2)
   04972 Pancreatic secretion
    11932 (Atp1b2)
   04976 Bile secretion
    11932 (Atp1b2)
   04973 Carbohydrate digestion and absorption
    11932 (Atp1b2)
   04974 Protein digestion and absorption
    11932 (Atp1b2)
   04978 Mineral absorption
    11932 (Atp1b2)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    11932 (Atp1b2)
   04961 Endocrine and other factor-regulated calcium reabsorption
    11932 (Atp1b2)
   04964 Proximal tubule bicarbonate reclamation
    11932 (Atp1b2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mmu04090]
    11932 (Atp1b2)
CD molecules [BR:mmu04090]
 Proteins
  11932 (Atp1b2)
SSDB
Motif
Pfam: Na_K-ATPase
Other DBs
NCBI-GeneID: 11932
NCBI-ProteinID: NP_038201
MGI: 88109
Ensembl: ENSMUSG00000041329
Vega: OTTMUSG00000005985
UniProt: P14231 Q3UR55
Position
11 B3; 11 42.86 cM
AA seq 290 aa
MVIQKEKKSCGQVVEEWKEFVWNPRTHQFMGRTGTSWAFILLFYLVFYGFLTAMFSLTMW
VMLQTVSDHTPKYQDRLATPGLMIRPKTENLDVIVNISDTESWGQHVQKLNKFLEPYNDS
IQAQKNDVCRPGRYYEQPDNGVLNYPKRACQFNRTQLGDCSGIGDPTHYGYSTGQPCVFI
KMNRVINFYAGANQSMNVTCVGKRDEDAENLGHFVMFPANGSIDLMYFPYYGKKFHVNYT
QPLVAVKFLNVTPNVEVNVECRINAANIATDDERDKFAGRVAFKLRINKT
NT seq 873 nt   +upstreamnt  +downstreamnt
atggtcatccagaaagagaagaagagctgcgggcaggtggttgaggagtggaaggagttc
gtgtggaacccgcggacgcaccagttcatggggcgcaccgggaccagctgggccttcatc
ctcctcttctacctcgtcttctatggtttcctcacggccatgttcagcctcaccatgtgg
gtaatgctgcagaccgtctctgaccatacccccaagtaccaggatcgactggccacacca
ggcttgatgattcgacccaagactgagaaccttgatgtcattgtcaacattagtgacact
gaaagctggggtcagcatgttcagaagctcaacaagttcttggaaccttacaacgactcc
atccaagcacagaagaatgatgtctgccgtccagggcgatattatgagcaacctgataat
ggggttctgaactacccaaaacgtgcctgccagttcaaccggacccaactgggcgattgc
tctggcattggggaccctacccactatggttacagcaccgggcagccctgtgtcttcatc
aaaatgaatcgggtcatcaacttctatgcaggggcaaaccagagcatgaatgtcacttgt
gttggcaagagagatgaagatgctgagaaccttggccactttgtcatgttccctgctaat
ggcagcattgatctgatgtactttccctactatggcaaaaagttccatgtaaactatact
cagcctttggtggctgtaaagttcctgaatgtgacccccaacgtggaggtgaatgttgaa
tgccgcatcaacgctgccaatattgccacagacgatgagcgggacaagttcgctggccgt
gtggccttcaaactccggatcaacaaaacctga

KEGG   Mus musculus (mouse): 11933
Entry
11933             CDS       T01002                                 

Symbol
Atp1b3, AA409958, AI664000, AW212096
Name
(RefSeq) ATPase, Na+/K+ transporting, beta 3 polypeptide
  KO
K01540  sodium/potassium-transporting ATPase subunit beta
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04022  cGMP-PKG signaling pathway
mmu04024  cAMP signaling pathway
mmu04260  Cardiac muscle contraction
mmu04261  Adrenergic signaling in cardiomyocytes
mmu04911  Insulin secretion
mmu04918  Thyroid hormone synthesis
mmu04919  Thyroid hormone signaling pathway
mmu04925  Aldosterone synthesis and secretion
mmu04960  Aldosterone-regulated sodium reabsorption
mmu04961  Endocrine and other factor-regulated calcium reabsorption
mmu04964  Proximal tubule bicarbonate reclamation
mmu04970  Salivary secretion
mmu04971  Gastric acid secretion
mmu04972  Pancreatic secretion
mmu04973  Carbohydrate digestion and absorption
mmu04974  Protein digestion and absorption
mmu04976  Bile secretion
mmu04978  Mineral absorption
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    11933 (Atp1b3)
   04022 cGMP-PKG signaling pathway
    11933 (Atp1b3)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    11933 (Atp1b3)
   04918 Thyroid hormone synthesis
    11933 (Atp1b3)
   04919 Thyroid hormone signaling pathway
    11933 (Atp1b3)
   04925 Aldosterone synthesis and secretion
    11933 (Atp1b3)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    11933 (Atp1b3)
   04261 Adrenergic signaling in cardiomyocytes
    11933 (Atp1b3)
  09154 Digestive system
   04970 Salivary secretion
    11933 (Atp1b3)
   04971 Gastric acid secretion
    11933 (Atp1b3)
   04972 Pancreatic secretion
    11933 (Atp1b3)
   04976 Bile secretion
    11933 (Atp1b3)
   04973 Carbohydrate digestion and absorption
    11933 (Atp1b3)
   04974 Protein digestion and absorption
    11933 (Atp1b3)
   04978 Mineral absorption
    11933 (Atp1b3)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    11933 (Atp1b3)
   04961 Endocrine and other factor-regulated calcium reabsorption
    11933 (Atp1b3)
   04964 Proximal tubule bicarbonate reclamation
    11933 (Atp1b3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mmu04090]
    11933 (Atp1b3)
CD molecules [BR:mmu04090]
 Proteins
  11933 (Atp1b3)
SSDB
Motif
Pfam: Na_K-ATPase
Other DBs
NCBI-GeneID: 11933
NCBI-ProteinID: NP_031528
MGI: 107788
Ensembl: ENSMUSG00000032412
Vega: OTTMUSG00000047571
UniProt: P97370 Q544Q7
Position
9 E3.3; 9 50.31 cM
AA seq 278 aa
MTKTEKKSFHQSLAEWKLFIYNPSSGEFLGRTSKSWGLILLFYLVFYGFLAALFTFTMWA
MLQTLNDEVPKYRDQIPSPGLMVFPKPQTALEYTFSMSEPQTYKKLVEDLESFLKPYSVE
EQKNLTSCPDGAPFIQHGPDYRACQFPVSLLEECSGVTDANFGYSKGQPCILVKMNRIID
LIPDGYPQISCLPKEENATIATYPEFGVLDLKYFPYYGKKRHVGYRQPLVAVQVKFDSGL
NKKEVTVECHIAGTRNLKNKNERDKFLGRVSFKVTARA
NT seq 837 nt   +upstreamnt  +downstreamnt
atgacgaagactgagaagaaatccttccaccagagcctggccgagtggaagctgttcatc
tacaacccgagcagcggagagtttctggggcgcacctccaagagctggggtctgatcttg
ctcttctacctagttttttatgggttcttggctgcactcttcacattcacaatgtgggcc
atgctccagactctgaatgatgaagttccgaaatatcgagaccagattcctagtccagga
cttatggtttttcccaaaccgcagactgccttggaatatacattcagcatgtctgagcca
cagacttacaaaaagttggttgaagacctggagagtttcctaaagccatattctgtggaa
gaacagaagaacctcacaagttgtcctgatggagcgccttttattcagcatggtcctgac
tatagggcatgtcagtttccagtctccttgcttgaagaatgtagtggtgtgactgatgct
aattttggctattccaaaggacagccttgcatccttgtgaaaatgaacagaataatcgat
ttaatcccagacggatatccacaaatatcgtgtttgccaaaggaagaaaacgcaactata
gcaacttatcctgaatttggagttttagacttaaagtattttccatattatgggaaaaaa
cggcatgttggatatcgacagcccctagttgccgtacaggtcaaatttgactctggtctt
aacaagaaagaagtaacagttgagtgccatattgctggaaccaggaacctaaaaaacaag
aatgagcgtgacaagttcttgggacgtgtttcgttcaaagtcacagcacgagcctag

KEGG   Mus musculus (mouse): 11936
Entry
11936             CDS       T01002                                 

Symbol
Fxyd2, Atp1g1
Name
(RefSeq) FXYD domain-containing ion transport regulator 2
  KO
K01538  sodium/potassium-transporting ATPase subunit gamma (FXYD domain-containing ion transport regulator 2)
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04022  cGMP-PKG signaling pathway
mmu04024  cAMP signaling pathway
mmu04260  Cardiac muscle contraction
mmu04261  Adrenergic signaling in cardiomyocytes
mmu04911  Insulin secretion
mmu04918  Thyroid hormone synthesis
mmu04919  Thyroid hormone signaling pathway
mmu04960  Aldosterone-regulated sodium reabsorption
mmu04961  Endocrine and other factor-regulated calcium reabsorption
mmu04964  Proximal tubule bicarbonate reclamation
mmu04970  Salivary secretion
mmu04972  Pancreatic secretion
mmu04973  Carbohydrate digestion and absorption
mmu04974  Protein digestion and absorption
mmu04976  Bile secretion
mmu04978  Mineral absorption
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    11936 (Fxyd2)
   04022 cGMP-PKG signaling pathway
    11936 (Fxyd2)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    11936 (Fxyd2)
   04918 Thyroid hormone synthesis
    11936 (Fxyd2)
   04919 Thyroid hormone signaling pathway
    11936 (Fxyd2)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    11936 (Fxyd2)
   04261 Adrenergic signaling in cardiomyocytes
    11936 (Fxyd2)
  09154 Digestive system
   04970 Salivary secretion
    11936 (Fxyd2)
   04972 Pancreatic secretion
    11936 (Fxyd2)
   04976 Bile secretion
    11936 (Fxyd2)
   04973 Carbohydrate digestion and absorption
    11936 (Fxyd2)
   04974 Protein digestion and absorption
    11936 (Fxyd2)
   04978 Mineral absorption
    11936 (Fxyd2)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    11936 (Fxyd2)
   04961 Endocrine and other factor-regulated calcium reabsorption
    11936 (Fxyd2)
   04964 Proximal tubule bicarbonate reclamation
    11936 (Fxyd2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    11936 (Fxyd2)
   04147 Exosome [BR:mmu04147]
    11936 (Fxyd2)
Transporters [BR:mmu02000]
 Other transporters
  Pores ion channels [TC:1]
   11936 (Fxyd2)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   11936 (Fxyd2)
SSDB
Motif
Pfam: ATP1G1_PLM_MAT8
Other DBs
NCBI-GeneID: 11936
NCBI-ProteinID: NP_031529
MGI: 1195260
Ensembl: ENSMUSG00000059412
Vega: OTTMUSG00000063508
UniProt: Q04646 Q6ITT2
Position
9; 9 A5.2
AA seq 70 aa
MAGEISDLSANSGGSAKGTENPFEYDYETVRKGGLIFAGLAFVVGLLIILSKRFRCGGGK
KHRQVNEDEL
NT seq 213 nt   +upstreamnt  +downstreamnt
atggctggggaaatatcagatctgtcagcgaacagtggtggcagtgccaaggggacagag
aatcccttcgagtacgactatgaaaccgtccgcaaaggaggcctgatcttcgcgggcctg
gccttcgtcgtgggcctcctcatcattctcagcaaaaggttccgctgtgggggcggtaag
aaacataggcaggtcaatgaagatgaactgtga

KEGG   Mus musculus (mouse): 232975
Entry
232975            CDS       T01002                                 

Symbol
Atp1a3, Atpa-2
Name
(RefSeq) ATPase, Na+/K+ transporting, alpha 3 polypeptide
  KO
K01539  sodium/potassium-transporting ATPase subunit alpha [EC:7.2.2.13]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04022  cGMP-PKG signaling pathway
mmu04024  cAMP signaling pathway
mmu04260  Cardiac muscle contraction
mmu04261  Adrenergic signaling in cardiomyocytes
mmu04911  Insulin secretion
mmu04918  Thyroid hormone synthesis
mmu04919  Thyroid hormone signaling pathway
mmu04925  Aldosterone synthesis and secretion
mmu04960  Aldosterone-regulated sodium reabsorption
mmu04961  Endocrine and other factor-regulated calcium reabsorption
mmu04964  Proximal tubule bicarbonate reclamation
mmu04970  Salivary secretion
mmu04971  Gastric acid secretion
mmu04972  Pancreatic secretion
mmu04973  Carbohydrate digestion and absorption
mmu04974  Protein digestion and absorption
mmu04976  Bile secretion
mmu04978  Mineral absorption
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    232975 (Atp1a3)
   04022 cGMP-PKG signaling pathway
    232975 (Atp1a3)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    232975 (Atp1a3)
   04918 Thyroid hormone synthesis
    232975 (Atp1a3)
   04919 Thyroid hormone signaling pathway
    232975 (Atp1a3)
   04925 Aldosterone synthesis and secretion
    232975 (Atp1a3)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    232975 (Atp1a3)
   04261 Adrenergic signaling in cardiomyocytes
    232975 (Atp1a3)
  09154 Digestive system
   04970 Salivary secretion
    232975 (Atp1a3)
   04971 Gastric acid secretion
    232975 (Atp1a3)
   04972 Pancreatic secretion
    232975 (Atp1a3)
   04976 Bile secretion
    232975 (Atp1a3)
   04973 Carbohydrate digestion and absorption
    232975 (Atp1a3)
   04974 Protein digestion and absorption
    232975 (Atp1a3)
   04978 Mineral absorption
    232975 (Atp1a3)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    232975 (Atp1a3)
   04961 Endocrine and other factor-regulated calcium reabsorption
    232975 (Atp1a3)
   04964 Proximal tubule bicarbonate reclamation
    232975 (Atp1a3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    232975 (Atp1a3)
Enzymes [BR:mmu01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.2.2.13  Na+/K+-exchanging ATPase
     232975 (Atp1a3)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   232975 (Atp1a3)
  Exosomal proteins of other body fluids (saliva and urine)
   232975 (Atp1a3)
  Exosomal proteins of colorectal cancer cells
   232975 (Atp1a3)
  Exosomal proteins of bladder cancer cells
   232975 (Atp1a3)
SSDB
Motif
Pfam: E1-E2_ATPase Cation_ATPase_C Cation_ATPase Hydrolase Cation_ATPase_N Hydrolase_3
Other DBs
NCBI-GeneID: 232975
NCBI-ProteinID: NP_001277398
MGI: 88107
Ensembl: ENSMUSG00000040907
Vega: OTTMUSG00000016491
UniProt: Q6PIC6 Q8R0E8
Position
7 A3; 7 13.73 cM
AA seq 1013 aa
MGDKKDDKSSPKKSKAKERRDLDDLKKEVAMTEHKMSVEEVCRKYNTDCVQGLTHSKAQE
ILARDGPNALTPPPTTPEWVKFCRQLFGGFSILLWIGAILCFLAYGIQAGTEDDPSGDNL
YLGIVLAAVVIITGCFSYYQEAKSSKIMESFKNMVPQQALVIREGEKMQVNAEEVVVGDL
VEIKGGDRVPADLRIISAHGCKVDNSSLTGESEPQTRSPDCTHDNPLETRNITFFSTNCV
EGTARGVVVATGDRTVMGRIATLASGLEVGKTPIAIEIEHFIQLITGVAVFLGVSFFILS
LILGYTWLEAVIFLIGIIVANVPEGLLATVTVCLTLTAKRMARKNCLVKNLEAVETLGST
STICSDKTGTLTQNRMTVAHMWFDNQIHEADTTEDQSGTSFDKSSHTWVALSHIAGLCNR
AVFKGGQDNIPVLKRDVAGDASESALLKCIELSSGSVKLMRERNKKVAEIPFNSTNKYQL
SIHETEDPNDNRYLLVMKGAPERILDRCATILLQGKEQPLDEEMKEAFQNAYLELGGLGE
RVLGFCHYYLPEEQFPKGFAFDCDDVNFTTDNLCFVGLMSMIDPPRAAVPDAVGKCRSAG
IKVIMVTGDHPITAKAIAKGVGIISEGNETVEDIAARLNIPVSQVNPRDAKACVIHGTDL
KDFTSEQIDEILQNHTEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKKADI
GVAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGRLIFDNLKKSIAYTLTSNIPEITPF
LLFIMANIPLPLGTITILCIDLGTDMVPAISLAYEAAESDIMKRQPRNPRTDKLVNERLI
SMAYGQIGMIQALGGFFSYFVILAENGFLPGNLVGIRLNWDDRTVNDLEDSYGQQWTYEQ
RKVVEFTCHTAFFVSIVVVQWADLIICKTRRNSVFQQGMKNKILIFGLFEETALAAFLSY
CPGMDVALRMYPLKPSWWFCAFPYSFLIFVYDEIRKLILRRNPGGWVEKETYY
NT seq 3042 nt   +upstreamnt  +downstreamnt
atgggggacaaaaaagatgacaagagctcgcccaagaagagcaaggccaaagagcgccgg
gacctggatgacctcaagaaggaagtggctatgacagagcacaagatgtcagtagaagag
gtctgccggaaatacaatactgactgcgtgcagggtctgacacacagtaaagcccaggag
atcctagcccgggatgggcctaacgccctcacaccaccgcccaccaccccagaatgggtc
aagttctgccggcagctgtttggtggcttctctatcctgctgtggatcggggcaatcctt
tgcttcctggcctatggcatccaggcagggacggaggatgacccttccggtgacaatctg
tacctgggcatagtgctggccgcagtcgtgatcatcaccggctgcttctcctactaccaa
gaagccaagagttctaagatcatggagtccttcaagaacatggtcccccagcaagccctt
gtgatccgggaaggtgaaaagatgcaggtgaatgcggaggaggtggtggtcggggacctg
gtggagatcaagggtggtgaccgggtgccagctgacctgcgcatcatctcggcccatggc
tgcaaggtggacaactcctccctgactggcgaatctgagcctcagacccgctccccggac
tgcacacacgacaaccccctggagactcggaacatcaccttcttttccaccaactgcgtg
gaaggcaccgctcggggtgtggtggtagccacaggtgaccgcaccgtcatgggccgcatt
gccaccctggcctcgggcttggaggtgggcaagacgcccatcgccattgagattgagcat
ttcatccagctcattacgggcgtggccgtgttcctgggcgtgtccttcttcatcctctct
ctcattctgggttacacctggctcgaggcagtcatcttcctcatcggcatcattgtggcc
aatgtcccagaggggctgctggctactgtcacggtgtgtctgacgctgaccgccaagcgc
atggctcgcaagaactgcctggtgaagaacctggaggcggtggagacgctgggctccacg
tccaccatctgctcggacaagaccggcactctcacccagaaccgcatgaccgtcgcccac
atgtggtttgacaaccagatccacgaggcagacaccacagaggatcagtcagggacctct
ttcgacaagagctcacacacctgggtggccctgtcccacatcgccgggctctgcaaccgg
gccgtcttcaagggcgggcaggacaacatcccagtactcaagagggacgtggccggtgat
gcctccgagtctgccctgcttaagtgcattgagctgtcctcgggttccgtaaagctgatg
cgagaacggaacaagaaagtggctgagattccgttcaactcgaccaacaaataccagcta
tccatccatgagactgaggatcccaatgacaaccggtacctgctagtgatgaagggcgcc
cccgaacgcattctggaccgctgtgccaccatcctcctgcagggcaaggagcagcctctg
gatgaggagatgaaggaggccttccagaatgcctacctggagcttggtggcctgggcgag
cgtgtgctgggtttctgccattactacctgcctgaggaacagttccccaagggctttgcc
tttgactgtgatgacgtgaacttcaccacagacaacctttgctttgtgggtctcatgtcc
atgattgaccctccccgggcagccgtccctgacgctgtgggcaaatgccgaagcgcaggc
atcaaggtcatcatggtcaccggcgatcaccccatcactgccaaggccattgccaagggt
gtgggtatcatctctgagggtaacgagactgtcgaagacatcgctgcccggctcaacatc
cctgtcagccaggtgaaccccagggatgccaaagcctgtgtgattcacggcaccgacctc
aaggacttcacctcggagcagattgacgagattctgcagaaccacaccgagatcgtcttt
gcccgaacctcccctcagcagaagctcatcatcgtggagggctgtcagagacagggagca
attgtggctgtgactggcgatggtgtgaatgactcccctgctctgaagaaggctgacatc
ggggtggccatgggcattgctggctctgatgtctctaagcaggctgccgacatgattctg
ctggatgacaactttgcttccattgtcactggtgtggaggaaggccgcctgatctttgac
aacctgaagaaatccatcgcctacactctgactagcaacatccctgagatcacacccttc
ctgctcttcatcatggctaacatcccactgcctcttggcaccatcaccatcctctgcatt
gacctgggtaccgacatggtccctgcaatctccctggcctacgaggctgccgagagcgac
atcatgaagaggcagcccaggaacccacgcacagacaaactggtcaacgaaaggctcatc
agcatggcctacgggcagattgggatgatccaggccctcggtggtttcttctcctacttt
gtcatcctggcagaaaatggcttcttgcccggaaacctggtgggcatccggctcaactgg
gatgatcgcactgtcaatgacctagaagacagttatgggcagcagtggacttatgagcag
aggaaggtggtagagttcacatgccacacagccttctttgtgagtatcgtggtggtccag
tgggctgacctgatcatctgcaagaccaggaggaactccgtcttccagcagggcatgaag
aataagatcttgatcttcggcttgtttgaggagacggccctcgctgccttcctgtcctac
tgcccaggcatggatgtggcccttcgcatgtaccctctcaagcccagctggtggttctgt
gccttcccctacagtttcctcatcttcgtctatgatgagattcgcaaactcatcctgcgc
aggaaccccgggggttgggtggagaaagagacctactattga

KEGG   Mus musculus (mouse): 27222
Entry
27222             CDS       T01002                                 

Symbol
Atp1a4
Name
(RefSeq) ATPase, Na+/K+ transporting, alpha 4 polypeptide
  KO
K01539  sodium/potassium-transporting ATPase subunit alpha [EC:7.2.2.13]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04022  cGMP-PKG signaling pathway
mmu04024  cAMP signaling pathway
mmu04260  Cardiac muscle contraction
mmu04261  Adrenergic signaling in cardiomyocytes
mmu04911  Insulin secretion
mmu04918  Thyroid hormone synthesis
mmu04919  Thyroid hormone signaling pathway
mmu04925  Aldosterone synthesis and secretion
mmu04960  Aldosterone-regulated sodium reabsorption
mmu04961  Endocrine and other factor-regulated calcium reabsorption
mmu04964  Proximal tubule bicarbonate reclamation
mmu04970  Salivary secretion
mmu04971  Gastric acid secretion
mmu04972  Pancreatic secretion
mmu04973  Carbohydrate digestion and absorption
mmu04974  Protein digestion and absorption
mmu04976  Bile secretion
mmu04978  Mineral absorption
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    27222 (Atp1a4)
   04022 cGMP-PKG signaling pathway
    27222 (Atp1a4)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    27222 (Atp1a4)
   04918 Thyroid hormone synthesis
    27222 (Atp1a4)
   04919 Thyroid hormone signaling pathway
    27222 (Atp1a4)
   04925 Aldosterone synthesis and secretion
    27222 (Atp1a4)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    27222 (Atp1a4)
   04261 Adrenergic signaling in cardiomyocytes
    27222 (Atp1a4)
  09154 Digestive system
   04970 Salivary secretion
    27222 (Atp1a4)
   04971 Gastric acid secretion
    27222 (Atp1a4)
   04972 Pancreatic secretion
    27222 (Atp1a4)
   04976 Bile secretion
    27222 (Atp1a4)
   04973 Carbohydrate digestion and absorption
    27222 (Atp1a4)
   04974 Protein digestion and absorption
    27222 (Atp1a4)
   04978 Mineral absorption
    27222 (Atp1a4)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    27222 (Atp1a4)
   04961 Endocrine and other factor-regulated calcium reabsorption
    27222 (Atp1a4)
   04964 Proximal tubule bicarbonate reclamation
    27222 (Atp1a4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    27222 (Atp1a4)
Enzymes [BR:mmu01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.2.2.13  Na+/K+-exchanging ATPase
     27222 (Atp1a4)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   27222 (Atp1a4)
  Exosomal proteins of other body fluids (saliva and urine)
   27222 (Atp1a4)
  Exosomal proteins of colorectal cancer cells
   27222 (Atp1a4)
  Exosomal proteins of bladder cancer cells
   27222 (Atp1a4)
SSDB
Motif
Pfam: Cation_ATPase_C E1-E2_ATPase Cation_ATPase Hydrolase Cation_ATPase_N Hydrolase_3 Cation_efflux HAD DUF1290
Other DBs
NCBI-GeneID: 27222
NCBI-ProteinID: NP_038762
MGI: 1351335
Ensembl: ENSMUSG00000007107
Vega: OTTMUSG00000021836
UniProt: Q9WV27
Position
1 H3; 1 79.54 cM
AA seq 1032 aa
MEPGKEKEVEAPGELNQKPRPSTRSSTTNRQPKMKRRKKDLEELKKEVVMDDHKLTLDEL
SAKYSVDLTKGLSILEAQDILFQNGPNVLTPPPTTPEWVKFCRQLFGGFSLLLWTGACLC
FLAYGIHVNYYKENANKDNLYLGIVLSAVVIITGCFSYYQEAKSSKIMESFKNMVPQQAL
VIRDGEKMQINVRDVVLGDLVEVKGGDQIPADIRVISAQGCKVDNSSLTGESEPQSRCPD
CTHENPLETRNIIFFSTNCVEGTARGIVIATGDYTVMGRIASLTSGLQMGKTPIATEIEH
FIHLITAVAVFLGVSFFWLSIILGYTWLDAVIFLIGIIVANVPEGLLATVTVCLTLTAKR
MARKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHLWFDKTVYEADTSEEQTTGK
TFPKSSDTWFYLARIAGLCNRADFKPHQESVPIAKRATTGDASESALLKFIEQSYNPVSE
MRQKNPKVAEIPFNSTNKYQMSIHLLEDNSEAHVLLMKGAPERIFDFCSSFLLNGQEYPM
DEEMKMDFQNAYIELGGLGERVLGFCFLNLPSNFSKGFQFNTDELNFPMENLCFAGLISM
IDPPRTAVPDAVSKCRSAGIKVIMVTGDHPITAKAIAKSVGIISEGNDTAEDIAARLNIP
ISQVNNKSVKAIVVHGSELKDMESQQLDDILKSYKEIVFARTSPQQKLIIVEGCQRLGAI
VAVTGDGVNDSPALKKADIGIAMGITGSDVSKQAADMILLDDNFASIVTGVEEGRLIFDN
LKKSIAYTLTSNIPEITPFLLFIILSIPLPLGTITILCIDLGTDMVPAISLAYESPESDI
MKRLPRNPKTDNLVNNRLIGMAYGQIGMIQALAGFFTYFVILAENGFKPLDLLGIRLYWD
DTQLNDLEDSYGQQWTYEQRKVVEFTCQTAFFISIVIVQWADLIICKTRRNSLFKQGMKN
KILIFGLLEETVLAAFLSYVPGMDVSLRMYPLKINWWFCALPYSVLIFVYDEIRKLIIRR
RPGGWLEKETYY
NT seq 3099 nt   +upstreamnt  +downstreamnt
atggagcctggaaaagaaaaggaggtagaggcccctggtgagctgaatcagaaaccaaga
cccagcaccaggtcctcaactacaaatagacagccgaaaatgaaaagaaggaagaaagat
ttagaagagctgaagaaggaagtggttatggatgatcacaagctaacgttggatgagctg
agtgccaagtactctgtggacttgaccaagggtcttagcatcctagaagcccaggatatt
ctgtttcaaaatggaccgaatgtactaactcctcctccaaccactccagagtgggtcaaa
ttctgtagacaactgtttggtggcttctccctcctactgtggactggtgcctgtctctgc
ttcctggcctatggcatacatgtaaattattacaaagaaaacgccaacaaagataatctg
tacctggggattgtactatctgccgtggtcatcattaccggctgcttctcatattaccag
gaggccaagagctccaagatcatggagtcttttaagaacatggtgcctcagcaagctctg
gtgattcgagatggagagaaaatgcaaatcaatgtaagagatgtggttttgggagaccta
gtagaggtgaagggaggagaccaaatccctgctgatatcagggttatctcggcgcaagga
tgcaaggtagacaattcctccttgactggggagtcagaaccccagtctcgctgccctgat
tgcactcatgagaaccctctggagacacggaatatcatcttcttctccactaactgtgta
gaaggaacagctcggggtattgtgattgctacaggagactacacagtaatgggccggatt
gcttccctgacatcaggcttgcaaatgggcaagaccccgattgccaccgaaatcgaacac
ttcatccatttgatcacagctgtcgcggtcttcctcggtgtttcatttttttggctctcg
attatcttgggttacacctggctggatgctgtcattttccttattggtatcattgtggcc
aatgtgccggaagggctgctggccactgtcactgtgtgcctgacgctgaccgccaagcgc
atggctcgcaagaactgcctggtgaagaacctggaggccgtggagacgctgggctccacg
tccaccatctgctcagacaagacgggcaccctcacccagaaccgcatgacagtggcgcat
ttgtggtttgataagactgtgtatgaggccgacaccagtgaggagcaaaccacggggaaa
acgtttcccaagtcctcagacacctggttttacctggctcgaatcgctggcctctgtaac
cgggccgactttaaaccccatcaggagtctgttcccatagctaagcgggcaacaacaggg
gatgcttccgagtcagctctcctcaaattcattgagcagtcttacaaccccgtgagcgaa
atgaggcagaaaaaccccaaggtggcggagattccctttaactccaccaacaagtatcag
atgtccatccaccttctggaagataattccgaagcccacgtgctgctaatgaaaggtgcc
ccagagaggatctttgatttttgctccagtttcctgctgaatgggcaggagtaccctatg
gatgaggaaatgaagatggacttccagaatgcctacatagaactgggaggtctgggcgaa
cgtgtgctggggttctgcttcttgaacttgcctagcaatttctctaaggggttccagttt
aataccgatgagttaaattttcccatggaaaatctgtgtttcgcgggcctcatctccatg
attgatcctcctcggacggccgtgcctgacgctgtgagcaaatgtcgaagcgcggggatc
aaggtgatcatggtaacgggggatcatcccatcacagccaaagctattgccaaaagtgtg
ggtatcatttcagaaggtaacgacacggcggaggacattgccgctcggctgaatatccct
atcagtcaagtcaataacaagtctgttaaagccattgtagtgcacggctcagaactgaaa
gacatggaatcccaacagctggacgacatcctcaagtcctataaggagattgtctttgcc
cggacctctcctcagcagaaactcatcattgtggaggggtgtcagcgactgggagccatt
gtggcagtgactggtgacggggtgaacgactcccccgcactgaagaaggctgacatcggc
attgccatgggcatcacaggctctgatgtctctaaacaggcggctgacatgatccttctt
gacgacaattttgcctccattgtgacaggcgtggaggagggccgcctcatctttgacaac
ctgaagaagtccatcgcatacaccctgaccagcaacatccctgagatcacccccttcctg
ctgttcatcatcttaagcatacccttgcctctgggcaccataaccattctctgcatcgac
ctgggcactgacatggtccctgctatctccctggcttatgaatcacctgaaagtgacatc
atgaaaaggcttccacggaaccccaaaacggacaatcttgtgaacaaccgtcttattggc
atggcctatgggcagattgggatgatacaggctctggctggatttttcacctattttgtg
atcctggcggagaatggttttaagcctcttgatcttctgggtatccgtctatactgggat
gatacacaattaaatgacctagaggacagctatgggcagcagtggacctatgagcagcgg
aaggtggtggaattcacatgccaaacggccttcttcatcagtatcgtgattgtgcagtgg
gctgacctcatcatctgcaagacacgcagaaattcactcttcaagcagggcatgaaaaac
aaaatcctaatatttggactccttgaggagacagtcctggcagctttcctgtcctacgtt
ccaggcatggatgtgtccctgcggatgtacccactcaagataaactggtggttctgcgca
cttccctacagtgttctcatcttcgtctatgatgaaatcagaaaacttatcatccggaga
cggcctggtggatggctggagaaggagacgtactactaa

KEGG   Mus musculus (mouse): 67821
Entry
67821             CDS       T01002                                 

Symbol
Atp1b4, 1110020B02Rik
Name
(RefSeq) ATPase, (Na+)/K+ transporting, beta 4 polypeptide
  KO
K01540  sodium/potassium-transporting ATPase subunit beta
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04022  cGMP-PKG signaling pathway
mmu04024  cAMP signaling pathway
mmu04260  Cardiac muscle contraction
mmu04261  Adrenergic signaling in cardiomyocytes
mmu04911  Insulin secretion
mmu04918  Thyroid hormone synthesis
mmu04919  Thyroid hormone signaling pathway
mmu04925  Aldosterone synthesis and secretion
mmu04960  Aldosterone-regulated sodium reabsorption
mmu04961  Endocrine and other factor-regulated calcium reabsorption
mmu04964  Proximal tubule bicarbonate reclamation
mmu04970  Salivary secretion
mmu04971  Gastric acid secretion
mmu04972  Pancreatic secretion
mmu04973  Carbohydrate digestion and absorption
mmu04974  Protein digestion and absorption
mmu04976  Bile secretion
mmu04978  Mineral absorption
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    67821 (Atp1b4)
   04022 cGMP-PKG signaling pathway
    67821 (Atp1b4)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    67821 (Atp1b4)
   04918 Thyroid hormone synthesis
    67821 (Atp1b4)
   04919 Thyroid hormone signaling pathway
    67821 (Atp1b4)
   04925 Aldosterone synthesis and secretion
    67821 (Atp1b4)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    67821 (Atp1b4)
   04261 Adrenergic signaling in cardiomyocytes
    67821 (Atp1b4)
  09154 Digestive system
   04970 Salivary secretion
    67821 (Atp1b4)
   04971 Gastric acid secretion
    67821 (Atp1b4)
   04972 Pancreatic secretion
    67821 (Atp1b4)
   04976 Bile secretion
    67821 (Atp1b4)
   04973 Carbohydrate digestion and absorption
    67821 (Atp1b4)
   04974 Protein digestion and absorption
    67821 (Atp1b4)
   04978 Mineral absorption
    67821 (Atp1b4)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    67821 (Atp1b4)
   04961 Endocrine and other factor-regulated calcium reabsorption
    67821 (Atp1b4)
   04964 Proximal tubule bicarbonate reclamation
    67821 (Atp1b4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mmu04090]
    67821 (Atp1b4)
CD molecules [BR:mmu04090]
 Proteins
  67821 (Atp1b4)
SSDB
Motif
Pfam: Na_K-ATPase
Other DBs
NCBI-GeneID: 67821
NCBI-ProteinID: NP_598451
MGI: 1915071
Ensembl: ENSMUSG00000016327
Vega: OTTMUSG00000017229
UniProt: Q99ME6
Position
X; X A3.3
AA seq 356 aa
MRRQLRSRRAPAFPYGYRYRLDDQDEANHNYLADEEEEAEEEAQVMMVPGLEEEEEEEEG
KEEEEEREEEEGQGQSTGSAWWRKLQIVNEYLWDPEKRMSLARTGQSRSLILVIYFFFYA
SLAAVITLFIYMLFLAISPYMPTFTEQVKPPGVMIRPFAHSLNFNFNVSEPETWQRYVIS
LNGFLQGYNDSLQEEMNIDCPPGRYFIQDGDEDEDKKACQFKRSFLKNCSGLEDPTFGYS
TGQPCILLKMNRIVGFRPEFGDPVKVSCKVQKGDENDIRSINYYPESASFDLRYYPYYGK
LTHVNYTSPLVAMHFTDVVKNQAVPVQCQLKGKGIVNDVINDRFVGRIIFTLNIET
NT seq 1071 nt   +upstreamnt  +downstreamnt
atgagacggcaactccgctccagaagggctcccgcctttccttacggttatcgctacaga
cttgatgatcaggatgaagcgaatcacaactacttagcagatgaagaggaggaagctgaa
gaggaggctcaggtgatgatggtgcctggtctagaggaagaggaagaagaggaggaagga
aaagaggaggaggaagaaagggaggaagaagaaggtcagggtcagtcaacaggcagtgcc
tggtggcggaaattgcagatcgtgaatgaatacctgtgggacccggagaaaaggatgtct
ctggcccgaacaggtcagagtcggagtcttattttagtcatttacttcttcttctatgcc
tccctggctgccgtgatcaccctgttcatatacatgctgttcctagccatcagtccttac
atgccgaccttcaccgagcaggtgaaacctcctggagttatgatcagacccttcgctcat
agccttaacttcaacttcaacgtttctgaacctgaaacttggcagcgttacgtgattagc
ctaaatggctttctccagggctataatgacagtcttcaagaggaaatgaatatagattgt
cctccgggtcggtacttcatccaagatggagatgaagatgaggacaagaaggcctgccaa
tttaagcgctccttcctgaagaattgctctgggttggaggatcccacttttggatactct
actggacagccttgcatcctcctcaagatgaaccggattgtaggcttccgtcctgagttt
ggagatcctgtgaaggtgtcctgcaaagttcagaaaggtgatgaaaatgacattcgatcc
atcaattactacccggagtccgcttcttttgacctccgctactacccttactatggcaaa
ctgactcatgttaactacacctccccgctggtggcaatgcattttacagatgtggtgaag
aaccaagcagtgcctgtacagtgccagctgaagggcaaaggcatcgtaaatgatgtcatc
aatgatcgttttgttgggaggataatctttaccctgaacatagaaacctag

KEGG   Mus musculus (mouse): 98660
Entry
98660             CDS       T01002                                 

Symbol
Atp1a2, AW060654, Atpa-3, mKIAA0778
Name
(RefSeq) ATPase, Na+/K+ transporting, alpha 2 polypeptide
  KO
K01539  sodium/potassium-transporting ATPase subunit alpha [EC:7.2.2.13]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04022  cGMP-PKG signaling pathway
mmu04024  cAMP signaling pathway
mmu04260  Cardiac muscle contraction
mmu04261  Adrenergic signaling in cardiomyocytes
mmu04911  Insulin secretion
mmu04918  Thyroid hormone synthesis
mmu04919  Thyroid hormone signaling pathway
mmu04925  Aldosterone synthesis and secretion
mmu04960  Aldosterone-regulated sodium reabsorption
mmu04961  Endocrine and other factor-regulated calcium reabsorption
mmu04964  Proximal tubule bicarbonate reclamation
mmu04970  Salivary secretion
mmu04971  Gastric acid secretion
mmu04972  Pancreatic secretion
mmu04973  Carbohydrate digestion and absorption
mmu04974  Protein digestion and absorption
mmu04976  Bile secretion
mmu04978  Mineral absorption
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    98660 (Atp1a2)
   04022 cGMP-PKG signaling pathway
    98660 (Atp1a2)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    98660 (Atp1a2)
   04918 Thyroid hormone synthesis
    98660 (Atp1a2)
   04919 Thyroid hormone signaling pathway
    98660 (Atp1a2)
   04925 Aldosterone synthesis and secretion
    98660 (Atp1a2)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    98660 (Atp1a2)
   04261 Adrenergic signaling in cardiomyocytes
    98660 (Atp1a2)
  09154 Digestive system
   04970 Salivary secretion
    98660 (Atp1a2)
   04971 Gastric acid secretion
    98660 (Atp1a2)
   04972 Pancreatic secretion
    98660 (Atp1a2)
   04976 Bile secretion
    98660 (Atp1a2)
   04973 Carbohydrate digestion and absorption
    98660 (Atp1a2)
   04974 Protein digestion and absorption
    98660 (Atp1a2)
   04978 Mineral absorption
    98660 (Atp1a2)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    98660 (Atp1a2)
   04961 Endocrine and other factor-regulated calcium reabsorption
    98660 (Atp1a2)
   04964 Proximal tubule bicarbonate reclamation
    98660 (Atp1a2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    98660 (Atp1a2)
Enzymes [BR:mmu01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.2.2.13  Na+/K+-exchanging ATPase
     98660 (Atp1a2)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   98660 (Atp1a2)
  Exosomal proteins of other body fluids (saliva and urine)
   98660 (Atp1a2)
  Exosomal proteins of colorectal cancer cells
   98660 (Atp1a2)
  Exosomal proteins of bladder cancer cells
   98660 (Atp1a2)
SSDB
Motif
Pfam: E1-E2_ATPase Cation_ATPase_C Cation_ATPase Hydrolase Cation_ATPase_N Hydrolase_3 Sigma70_r4
Other DBs
NCBI-GeneID: 98660
NCBI-ProteinID: NP_848492
MGI: 88106
Ensembl: ENSMUSG00000007097
Vega: OTTMUSG00000021834
UniProt: Q6PIE5 Q3UHK5
Position
1 H3; 1 79.6 cM
AA seq 1020 aa
MGRGAGREYSPAATTAENGGGKKKQKEKELDELKKEVAMDDHKLSLDELGRKYQVDLSKG
LTNQRAQDILARDGPNALTPPPTTPEWVKFCRQLFGGFSILLWIGALLCFLAYGILAAME
DEPSNDNLYLGIVLAAVVIVTGCFSYYQEAKSSKIMDSFKNMVPQQALVIREGEKMQINA
EEVVVGDLVEVKGGDRVPADLRIISSHGCKVDNSSLTGESEPQTRSPEFTHENPLETRNI
CFFSTNCVEGTARGIVIATGDRTVMGRIATLASGLEVGQTPIAMEIEHFIQLITGVAVFL
GVSFFVLSLILGYSWLEAVIFLIGIIVANVPEGLLATVTVCLTLTAKRMARKNCLVKNLE
AVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNQIHEADTTEDQSGATFDKRSPTWTALS
RIAGLCNRAVFKAGQENISVSKRDTAGDASESALLKCIELSCGSVRKMRDRNPKVAEIPF
NSTNKYQLSIHEREDSPQSHVLVMKGAPERILDRCSTILVQGKEIPLDKEMQDAFQNAYM
ELGGLGERVLGFCQLNLPSGKFPRGFKFDTDELNFPTEKLCFVGLMSMIDPPRAAVPDAV
GKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGNETVEDIAARLNIPVSQVNPREAKAC
VVHGSDLKDMTSEQLDEILRDHTEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSP
ALKKADIGIAMGISGSDVSKQAADMILLDDNFASIVTGVEEGRLIFDNLKKSIAYTLTSN
IPEITPFLLFIIANIPLPLGTVTILCIDLGTDMVPAISLAYEAAESDIMKRQPRNSQTDK
LVNERLISMAYGQIGMIQALGGFFTYFVILAENGFLPSRLLGIRLDWDDRTTNDLEDSYG
QEWTYEQRKVVEFTCHTAFFASIVVVQWADLIICKTRRNSVFQQGMKNKILIFGLLEETA
LAAFLSYCPGMGVALRMYPLKVTWWFCAFPYSLLIFIYDEVRKLILRRYPGGWVEKETYY
NT seq 3063 nt   +upstreamnt  +downstreamnt
atgggtcgtggggcagggcgtgagtactcgcctgctgccaccactgcggaaaatgggggt
ggcaagaagaaacagaaagagaaggagctcgatgagctgaagaaggaggttgccatggat
gaccacaagctgtccttggatgagctgggccgaaaataccaagtggatctgtctaagggc
ctcaccaatcagcgagctcaggacattctggctagagatggacccaacgcccttactccg
ccccccacaactcctgagtgggtcaagttctgtcgtcagctttttgggggcttctctatc
ctgctgtggattggggcactcctctgcttcttagcctatggtatcctggccgctatggag
gacgaaccatccaacgataatttatatctaggtatcgtgctagcggctgtagttatcgtc
accggctgcttctcctactaccaggaagccaagagctccaagatcatggactccttcaag
aacatggtgcctcagcaagctctggtcatccgagagggagaaaagatgcagatcaatgca
gaggaggtggtggtgggagacctggtggaggtgaagggtggagaccgtgtccctgctgac
ctccggatcatctcttcccacggttgcaaggtggataactcatccctaacaggggagtcg
gagccccagacccgttctcctgagttcacccacgagaaccccttggagacgcgcaatatc
tgtttcttctctaccaactgcgtggaaggcactgccaggggcattgtgattgccacaggt
gaccggacagtgatgggccgcatagccactcttgcctctggcctagaggtgggacagaca
cccatagccatggagatcgagcatttcatccagctgatcacaggggtggctgtgttcctg
ggggtctccttcttcgttctgtccctcatcctgggctacagctggctggaggcagtcatc
ttcctcatcggcatcatcgtagccaatgtgcccgaagggctgttggccaccgtgactgtg
tgcctgacgctgacagccaagcgcatggctcgcaaaaactgcctggtgaagaacctggag
gccgtggagacgctgggctccacgtccaccatctgctcagacaagacgggcaccctcacc
cagaaccgcatgacagtggctcacatgtggtttgacaaccagatccatgaggctgacacc
acagaggaccagtctggggccacttttgacaaacggtcccccacatggacagccctgtct
cggatcgctggtctctgcaatcgtgctgtcttcaaggctggacaagagaacatctccgtg
tctaagcgggacacagctggagatgcttctgagtcagctctgctcaagtgcattgagctg
tcctgtggctcagtgaggaagatgagggacaggaaccctaaggtggcagaaatccccttc
aactccaccaacaaatatcagctctccatccacgagagggaagacagtccccagagccat
gtgctggtgatgaaaggcgccccagagcgcatcctggaccgatgctccaccatcctggta
cagggcaaggagatccctcttgacaaggagatgcaagatgcttttcaaaacgcctacatg
gagctgggaggacttggggaacgagtgctgggcttctgtcagctgaacctgccttctgga
aagtttcctcggggcttcaaatttgatacagatgagctgaactttcccacagagaagctc
tgttttgtggggctcatgtctatgattgatccccccagagcagccgtgccggatgccgtg
ggcaagtgccgaagcgcgggcatcaaggtgatcatggtgaccggggatcaccccatcaca
gctaaggccattgccaaaggtgtgggcatcatatcagagggtaacgagactgtggaagac
attgcagccaggctcaacattcctgtgagtcaagtcaatcccagagaagccaaggcgtgt
gtagtgcacggctcagacctgaaggacatgacgtcagagcagctggatgagatcctcagg
gaccacacggagattgtctttgcccggacctcccctcagcagaagcttatcattgtggaa
gggtgtcagaggcagggagccattgtggcagtgactggtgacggggtgaacgactccccc
gcgctgaagaaggctgacattggcattgccatgggcatctccggctccgatgtctctaag
caggcggctgacatgatccttctcgacgacaactttgcctccattgtgacaggcgtggag
gagggccgcctgatctttgacaacttgaagaagtccatcgcatacaccctgaccagcaac
atccctgagatcacccccttcctgctgttcatcattgccaacatcccccttccactgggc
actgtgaccatcctctgcatcgacctggggacagatatggttcctgctatctcattagca
tacgaagcagctgagagtgacatcatgaagaggcagccacgaaactcccagacagacaag
ctggtgaacgagaggcttatcagcatggcttacggacagattggcatgatccaggctctg
ggtggcttctttacctactttgtgatactggcagagaatgggtttctaccatcgcggctg
ctagggatccgcctggactgggatgatcggactaccaacgacctggaggacagctatgga
caagagtggacctacgagcagcggaaggtggtggagttcacatgccacacggccttcttc
gctagcatcgtggttgtgcagtgggctgacctcatcatctgcaagacccgtcgcaactca
gtgttccagcagggcatgaagaacaagatcctgatttttgggctgctagaagagacggct
ttggctgcctttctgtcttactgcccgggcatgggggttgccctccggatgtacccactc
aaggtcacgtggtggttctgtgccttcccctacagtctcctcatcttcatctatgatgaa
gttcggaagctcatcctacggcggtaccctgggggctgggtggagaaggagacgtactac
tga

DBGET integrated database retrieval system