KEGG   Mus musculus (mouse): 12265
Entry
12265             CDS       T01002                                 

Gene name
Ciita, C2t, C2ta, EG669998, Gm9475, Mhc2ta
Definition
(RefSeq) class II transactivator
  KO
K08060  MHC class II transactivator [EC:2.7.11.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04612  Antigen processing and presentation
mmu05145  Toxoplasmosis
mmu05152  Tuberculosis
mmu05164  Influenza A
mmu05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    12265 (Ciita)
 09160 Human Diseases
  09172 Infectious disease: viral
   05164 Influenza A
    12265 (Ciita)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    12265 (Ciita)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    12265 (Ciita)
  09163 Immune disease
   05340 Primary immunodeficiency
    12265 (Ciita)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    12265 (Ciita)
  09183 Protein families: signaling and cellular processes
   04054 Pattern recognition receptors [BR:mmu04054]
    12265 (Ciita)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     12265 (Ciita)
Protein kinases [BR:mmu01001]
 Serine/threonine kinases: Other
  TAF1 family
   12265 (Ciita)
Pattern recognition receptors [BR:mmu04054]
 Cytoplasmic pattern recognition receptors
  NOD-like receptors
   12265 (Ciita)
SSDB
Motif
Pfam: NACHT LRR_6 NLRC4_HD2 LRR_8 LRR_4 LRR_9
Other DBs
NCBI-GeneID: 12265
NCBI-ProteinID: NP_001289547
MGI: 108445
Ensembl: ENSMUSG00000022504
UniProt: P79621 Q3KNE0 Q3UU40 Q3U5G4 Q3UNW8
Position
16; 16 A1
AA seq 1155 aa
MNHFQAILAQVQTLLSSQKPRQVRALLDGLLEEELLSREYHCALLHEPDGDALARKISLT
LLEKGDLDLTFLSWVCNSLQAPTVERGTSYRDHGDHSLCATMDLGSPEGSYLELLNSDAD
PLHLYHLYDQMDLAGEEEIELSSEPDTDTINCDQFSKLLQDMELDEETREAYANIAELDQ
YVFQDTQLEGLSKDLFIEHIGAEEGFGENIEIPVEAGQKPQKRRFPEEHAMDSKHRKLVP
TSRTSLNYLDLPTGHIQIFTTLPQGLWQISGAGTGLSSVLIYHGEMPQVNQVLPSSSLSI
PSLPESPDRPGSTSPFTPSAADLPSMPEPALTSRVNETEDTSPSPCQEGPESSIKLPKWP
EAVERFQHSLQDKYKALPQSPRGPLVAVELVRARLERGSNKSQERELATPDWTERQLAHG
GLAEVLQVVSDCRRPGETQVVAVLGKAGQGKSHWARTVSHTWACGQLLQYDFVFYVPCHC
LDRPGDTYHLRDLLCPPSLQPLAMDDEVLDYIVRQPDRVLLILDAFEELEAQDGLLHGPC
GSLSPEPCSLRGLLAGIFQRKLLRGCTLLLTARPRGRLAQSLSKADAIFEVPSFSTKQAK
TYMRHYFENSGTAGNQDKALGLLEGQPLLCSYSHSPVVCRAVCQLSKALLEQGTEAQLPC
TLTGLYVSLLGPAAQNSPPGALVELAKLAWELGRRHQSTLQETRFSSVEVKTWAVTQGLM
QQTLETTEAQLAFSSFLLQCFLGAVWLAQCNEIKDKELPQYLALTPRKKRPYDNWLEGVP
RFLAGLVFQPRAHCLGALVEPAVAAVADRKQKVLTRYLKRLKLGTLRAGRLLELLHCAHE
TQQPGIWEHVAHQLPGHLSFLGTRLTPPDVYVLGRALETASQDFSLDLRQTGVEPSGLGN
LVGLSCVTSFRASLSDTMALWESLQQQGEAQLLQAAEEKFTIEPFKAKSPKDVEDLDRLV
QTQRLRNPSEDAAKDLPAIRDLKKLEFALGPILGPQAFPTLAKILPAFSSLQHLDLDSLS
ENKIGDKGVSKLSATFPQLKALETLNLSQNNITDVGACKLAEALPALAKSLLRLSLYNNC
ICDKGAKSLAQVLPDMVSLRVMDVQFNKFTAAGAQQLASSLQKCPQVETLAMWTPTIPFG
VQEHLQQLDARISLR
NT seq 3468 nt   +upstreamnt  +downstreamnt
atgaaccacttccaggccatcctggcccaagtacagacactgctctccagccagaagccc
aggcaggtgcgggccctcctggatggcctgctggaagaagagctgctctcacgggaatac
cactgtgccttgctgcatgagcctgatggtgatgccctggcccggaagatttccctgacc
ctgctggagaaaggggacttagacttgactttcttgagctgggtctgcaacagtctgcag
gctcccacggtagagaggggcaccagctacagggaccatggagaccatagtctgtgtgcc
accatggatctgggatctccagagggcagctacctggaactccttaacagtgatgccgac
cccctacatctctaccacctctatgaccagatggacctggctggggaggaggagatcgaa
ctcagctcagagccagacacagataccatcaactgcgaccagttcagcaagctgttgcag
gacatggaactggatgaagagacccgggaggcctatgccaacattgcggaactggatcag
tacgtgttccaggatacccagctcgagggcctgagcaaggacctcttcatagagcacatt
ggagcagaggaaggctttggtgagaacatagagatccctgtagaagcaggacagaagcct
cagaagagacgcttcccggaagagcatgctatggactcaaagcacaggaagctagtgccc
acctctaggacctcactgaactatttggatctccccactgggcacatccagatcttcacc
actctgccccagggactctggcaaatctcaggggctggcacaggtctctccagtgtccta
atctaccacggtgagatgccccaggtcaaccaagtgctcccttcaagcagcctcagtatc
cccagtctccccgagtccccagaccggcctggctccaccagccccttcacaccatctgca
gctgacctgcccagcatgcccgaacctgcgctgacctcccgtgtaaatgagacagaggac
acatctccctccccatgccaagagggtcccgagtcttccatcaagcttccaaaatggcca
gaggctgtggagcgattccagcactccctacaggacaaatacaaggcattgccccagagc
ccaaggggtcctctggtggccgtggagctggtacgggccaggctggaaagaggcagcaac
aagagccaggaaagggagctggccactcccgactggacagagcgccagctagcccacggt
ggtctggcagaggtacttcaggttgtcagtgactgcaggcgaccaggagagacacaggtg
gtcgctgtgctgggcaaggctggccagggaaagagccactgggccaggacagtgagtcac
acctgggcatgtggccagttgctacaatatgactttgtcttctatgtcccctgtcattgc
ttggatcgtcccggggacacctaccacctgcgggatctgctctgtcccccgagcctgcag
ccactggccatggatgacgaggtccttgattatatcgtgaggcagccagaccgtgttctg
ctcatcctagatgctttcgaggagctagaggcccaagatggcctcctgcacggaccctgt
ggatctctgtccccagagccctgctccctccgaggactgctggctgggatcttccagcgg
aagctactgcgaggctgcacactgctcctcacagcccggccccggggccgcctggctcag
agcctgagcaaggcagatgccatctttgaggtgcccagcttctctaccaagcaggccaag
acttacatgaggcactactttgagaactcagggacagcggggaaccaagacaaggccctg
ggcctcctggagggccagcctcttctctgcagctatagtcacagccctgttgtgtgcagg
gctgtgtgccagctctccaaggccctgctagaacagggcacagaggcccagctaccttgt
acacttacaggactctatgtcagcctgctaggtcctgcagctcagaacagtcctcccgga
gccttagtcgagctggccaagctggcctgggagctgggacgaagacaccaaagcaccttg
caagaaacccggttttcatccgtggaggtgaaaacctgggcagtgacccaaggcttgatg
cagcagaccctggagaccacggaggctcaactggccttctccagttttctgctacagtgt
ttcctgggtgctgtgtggctggcacagtgcaatgaaatcaaagacaaggagctgccacag
tacctggccttgactccgaggaagaagagaccctatgacaactggctggagggtgtacca
cgctttctggctggattagttttccagcctcgagcccactgcctgggagctctggtggag
cctgcagtggctgcagtggcggataggaaacagaaggttcttaccaggtacctgaagcgc
ctgaagctggggacactccgggcagggaggctgctggagctgctccactgtgcccacgag
acacagcaacctgggatatgggagcatgttgcacaccagctccctggccacctctccttc
ctgggcacccggctcacacccccagatgtgtatgtgctgggcagggccttggagacagcc
agccaggacttctccttggaccttcgtcagactggcgttgagccttctggactgggaaac
ctcgtgggactcagctgtgtcaccagtttcagggcctccttgagtgatacaatggcatta
tgggagtcccttcagcagcagggagaagcccagctactccaggcggcagaggagaagttc
accattgagccatttaaagccaaatccccaaaggatgtggaagacctggatcgtctcgtg
cagacccagaggctgagaaacccctcagaagatgcagccaaggatcttcctgccatccgg
gaccttaagaagctagagtttgcgttgggccccatcttgggcccccaggctttccccaca
ctggcaaagatccttccagccttctcttctctgcaacacctggacctggactcacttagt
gagaacaagatcggagacaagggtgtgtcgaagctctcagccaccttccctcagctgaag
gccctggagacgctcaacttgtcccaaaacaacatcactgatgtgggtgcctgcaagctt
gcagaagctctgccagccctagccaagtccctcctaaggctgagcttgtacaataactgc
atctgtgacaaaggagccaagagcctggcacaagtacttccggacatggtgtccctgcgt
gtgatggatgtccagttcaacaagttcacggctgccggtgcccagcaactggcctccagc
cttcagaagtgccctcaggtggaaacactggcaatgtggacacccactatcccctttggg
gttcaggaacacctgcagcagctggatgccaggatcagtctgagatga

DBGET integrated database retrieval system