KEGG   Mus musculus (house mouse): 12286
Entry
12286             CDS       T01002                                 
Symbol
Cacna1a, APCA, BI, Caca1a, Cacnl1a4, Cav2.1, Ccha1a, EA2, FHM, HPCA, MHP, MHP1, SCA6, alpha1A, la, nmf352, rkr, smrl, tg
Name
(RefSeq) calcium channel, voltage-dependent, P/Q type, alpha 1A subunit
  KO
K04344  voltage-dependent calcium channel P/Q type alpha-1A
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04010  MAPK signaling pathway
mmu04020  Calcium signaling pathway
mmu04721  Synaptic vesicle cycle
mmu04723  Retrograde endocannabinoid signaling
mmu04724  Glutamatergic synapse
mmu04725  Cholinergic synapse
mmu04726  Serotonergic synapse
mmu04727  GABAergic synapse
mmu04728  Dopaminergic synapse
mmu04730  Long-term depression
mmu04742  Taste transduction
mmu04930  Type II diabetes mellitus
mmu05017  Spinocerebellar ataxia
mmu05032  Morphine addiction
mmu05033  Nicotine addiction
mmu05207  Chemical carcinogenesis - receptor activation
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    12286 (Cacna1a)
   04020 Calcium signaling pathway
    12286 (Cacna1a)
 09150 Organismal Systems
  09156 Nervous system
   04724 Glutamatergic synapse
    12286 (Cacna1a)
   04727 GABAergic synapse
    12286 (Cacna1a)
   04725 Cholinergic synapse
    12286 (Cacna1a)
   04728 Dopaminergic synapse
    12286 (Cacna1a)
   04726 Serotonergic synapse
    12286 (Cacna1a)
   04730 Long-term depression
    12286 (Cacna1a)
   04723 Retrograde endocannabinoid signaling
    12286 (Cacna1a)
   04721 Synaptic vesicle cycle
    12286 (Cacna1a)
  09157 Sensory system
   04742 Taste transduction
    12286 (Cacna1a)
 09160 Human Diseases
  09161 Cancer: overview
   05207 Chemical carcinogenesis - receptor activation
    12286 (Cacna1a)
  09164 Neurodegenerative disease
   05017 Spinocerebellar ataxia
    12286 (Cacna1a)
  09165 Substance dependence
   05032 Morphine addiction
    12286 (Cacna1a)
   05033 Nicotine addiction
    12286 (Cacna1a)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    12286 (Cacna1a)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mmu04040]
    12286 (Cacna1a)
Ion channels [BR:mmu04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   12286 (Cacna1a)
SSDB
Motif
Pfam: Ion_trans Ca_chan_IQ GPHH PKD_channel
Other DBs
NCBI-GeneID: 12286
NCBI-ProteinID: NP_031604
MGI: 109482
Ensembl: ENSMUSG00000034656
Vega: OTTMUSG00000031448
UniProt: P97445 Q3UHA5 Q3UHN4
Position
8:85065257..85366880
AA seq 2368 aa
MARFGDEMPGRYGAGGGGSGPAAGVVVGAAGGRGAGGSRQGGQPGAQRMYKQSMAQRART
MALYNPIPVRQNCLTVNRSLFLFSEDNVVRKYAKKITEWPPFEYMILATIIANCIVLALE
QHLPDDDKTPMSERLDDTEPYFIGIFCFEAGIKIVALGFAFHKGSYLRNGWNVMDFVVVL
TGILATVGTEFDLRTLRAVRVLRPLKLVSGIPSLQVVLKSIMKAMIPLLQIGLLLFFAIL
IFAIIGLEFYMGKFHTTCFEEGTDDIQGESPAPCGTEEPARTCPNGTKCQPYWEGPNNGI
TQFDNILFAVLTVFQCITMEGWTDLLYNSNDASGNTWNWLYFIPLIIIGSFFMLNLVLGV
LSGEFAKERERVENRRAFLKLRRQQQIERELNGYMEWISKAEEVILAEDETDVEQRHPFD
GALRRATLKKSKTDLLNPEEAEDQLADIASVGSPFARASIKSAKLENSTFFHKKERRMRF
YIRRMVKTQAFYWTVLSLVALNTLCVAIVHYNQPEWLSDFLYYAEFIFLGLFMSEMFIKM
YGLGTRPYFHSSFNCFDCGVIIGSIFEVIWAVIKPGTSFGISVLRALRLLRIFKVTKYWA
SLRNLVVSLLNSMKSIISLLFLLFLFIVVFALLGMQLFGGQFNFDEGTPPTNFDTFPAAI
MTVFQILTGEDWNEVMYDGIKSQGGVQGGMVFSIYFIVLTLFGNYTLLNVFLAIAVDNLA
NAQELTKDEQEEEEAANQKLALQKAKEVAEVSPLSAANMSIAVKEQQKNQKPTKSVWEQR
TSEMRKQNLLASREALYGDAAERWPTPYARPLRPDVKTHLDRPLVVDPQENRNNNTNKSR
APEALRPTARPRESARDPDARRAWPGSPERAPGREGPYGRESEPQQREHAPPREHAPWDA
DTERAKAGDAPRRHTHRPVAEGEPRRHRARRRPGDEPDDRPERRPRPRDATRPARAADGE
GDDGERKRRHRHGPPAHDDRERRHRRRKENQGSGVPVSGPNLSTTRPIQQDLGRQDLPLA
EDLDNMKNNKLATGEPASPHDSLGHSGLPPSPAKIGNSTNPGPALATNPQNAASRRTPNN
PGNPSNPGPPKTPENSLIVTNPSSTQPNSAKTARKPEHMAVEIPPACPPLNHTVVQVNKN
ANPDPLPKKEEEKKEEEEADPGEDGPKPMPPYSSMFILSTTNPLRRLCHYILNLRYFEMC
ILMVIAMSSIALAAEDPVQPNAPRNNVLRYFDYVFTGVFTFEMVIKMIDLGLVLHQGAYF
RDLWNILDFIVVSGALVAFAFTGNSKGKDINTIKSLRVLRVLRPLKTIKRLPKLKAVFDC
VVNSLKNVFNILIVYMLFMFIFAVVAVQLFKGKFFHCTDESKEFERDCRGKYLLYEKNEV
KARDREWKKYEFHYDNVLWALLTLFTVSTGEGWPQVLKHSVDATFENQGPSPGYRMEMSI
FYVVYFVVFPFFFVNIFVALIIITFQEQGDKMMEEYSLEKNERACIDFAISAKPLTRHMP
QNKQSFQYRMWQFVVSPPFEYTIMAMIALNTIVLMMKFYGASVAYENALRVFNIVFTSLF
SLECVLKVMAFGILNYFRDAWNIFDFVTVLGSITDILVTEFGNNFINLSFLRLFRAARLI
KLLRQGYTIRILLWTFVQSFKALPYVCLLIAMLFFIYAIIGMQVFGNIGIDGEDEDSDED
EFQITEHNNFRTFFQALMLLFRSATGEAWHNIMLSCLSGKPCDKNSGILTADCGNEFAYF
YFVSFIFLCSFLMLNLFVAVIMDNFEYLTRDSSILGPHHLDEYVRVWAEYDPAACGRIHY
KDMYSLLRVISPPLGLGKKCPHRVACKRLLRMDLPVADDNTVHFNSTLMALIRTALDIKI
AKGGADKQQMDAELRKEMMAIWPNLSQKTLDLLVTPHKSTDLTVGKIYAAMMIMEYYRQS
KAKKLQAMREEQNRTPLMFQRMEPPSPTQEGGPSQNALPSTQLDPGGGLMAHEGGMKESP
SWVTQRAQEMFQKTGTWSPERGPPIDMPNSQPNSQSVEMREMGTDGYSDSEHYLPMEGQT
RAASMPRLPAENQRRRGRPRGNDLSTISDTSPMKRSASVLGPKARRLDDYSLERVPPEEN
QRYHQRRRDRGHRTSERSLGRYTDVDTGLGTDLSMTTQSGDLPSKDRDQDRGRPKDRKHR
PHHHHHHHHHHPPAPDRDRYAQERPDTGRARAREQRWSRSPSEGREHTTHRQGSSSVSGS
PAPSTSGTSTPRRGRRQLPQTPCTPRPLVSYSPAPRRPAARRMAGPAAPPGGSPRGCRRA
PRWPAHAPEGPRPRGADYTEPDSPREPPGGAHDPAPRSPRTPRAAGCASPRHGRRLPNGY
YAGHGAPRPRTARRGAHDAYSESEDDWC
NT seq 7107 nt   +upstreamnt  +downstreamnt
atggcccgctttggagacgagatgccgggccgctacggcgcaggcggaggaggctcaggg
ccggccgccggggtggtcgtgggcgccgcgggcggccgaggagccgggggcagccggcag
ggcgggcagcccggagcgcagaggatgtacaagcagtcgatggcgcagagagcgcggacc
atggccctctacaaccccatccctgtccgccagaactgcctcacggtcaaccgctccctg
ttcctcttcagtgaagacaacgtggtgagaaaatacgccaaaaagatcactgaatggcct
cccttcgagtacatgatcctggccaccatcattgctaactgcatcgtcctggccctggag
cagcacctccctgatgatgacaagacacccatgtctgagcggctggatgacacggaacca
tacttcattggaatcttctgttttgaggctggaattaagatcgtggctcttggctttgcc
ttccacaaaggctcctacctgaggaatggctggaacgtcatggactttgtcgtggtgcta
acaggcatcttggccactgtcgggacggagtttgacctacggacactgagggcggttcgt
gtgctgcggccactcaagctggtgtctggaatcccaagtttacaagtcgtcctgaagtca
atcatgaaggcgatgatccctctgctgcagatcggcctcctcctgttttttgcaatcctt
atttttgcaatcatagggttagaattttatatggggaaatttcataccacctgctttgaa
gaggggacagacgacatccagggtgagtcgccagctccgtgtgggacagaggagcctgcc
cgcacctgccccaacgggaccaaatgtcagccgtactgggaagggcccaacaacggcatc
actcagttcgacaacatcctgtttgctgtgctcactgttttccagtgcatcaccatggaa
ggctggactgatctcctctacaatagcaacgatgcctcagggaacacttggaactggttg
tacttcatccccctcatcatcatcggctccttttttatgctgaaccttgttctgggtgtg
ctgtctggggagtttgccaaagaaagggaacgtgtggagaaccggagagcttttctgaag
ctcagaagacaacagcagattgaacgtgagctcaatggatacatggagtggatctcaaaa
gcagaagaggtgattcttgcggaggacgagacagacgtggagcagaggcacccttttgat
ggagctcttcggagagctactctgaagaaaagcaagacagacctgctcaaccctgaggag
gccgaggaccagctggctgacatcgcgtctgtggggtctcccttcgccagagccagcatc
aaaagtgccaagctggagaactcgactttttttcacaagaaggagagaagaatgcgtttc
tacatccgccgcatggtcaaaactcaggccttctactggaccgtgctcagtctggtagcc
ctcaacacgctgtgcgtcgccattgtccactacaaccagcccgagtggctctccgacttc
ctctactatgcagaattcattttcttaggactctttatgtccgaaatgtttataaaaatg
tacgggctcgggacgcggccttacttccactcttccttcaactgctttgactgtggggtc
atcattgggagcatctttgaagtcatctgggctgtcatcaaacctggtacatcctttgga
atcagtgtgttacgagctctcaggttattgcgaattttcaaagtcacaaagtactgggca
tctctcagaaacctggttgtctccctcctcaactccatgaagtccatcataagtctgttg
ttcctccttttcctgttcatcgttgtctttgccctcctggggatgcagctgttcggtggc
caatttaattttgatgaggggactccgcccaccaacttcgacacttttccagcagcaata
atgactgtgtttcagatcctgactggcgaggattggaatgaggtcatgtatgatgggatc
aagtctcaggggggcgtgcagggcggcatggtgttctccatctacttcatcgtcctcacc
ctcttcgggaactacaccctgctgaacgtgttcttggccatcgcagtggacaacctggcc
aatgcccaggagctcaccaaggatgagcaagaagaggaagaggcagccaatcagaagctg
gctctacagaaagccaaggaggtagcagaagtgagtcccctgtctgcagccaacatgtcc
atagccgtgaaggagcagcagaagaaccagaagcctaccaagtcggtgtgggagcagcgc
accagcgagatgcgcaagcagaacctgctggccagccgcgaggcgctgtacggggacgcg
gctgagcgctggcccaccccctacgcgcgcccgctgcggcccgacgtgaagactcacttg
gaccggccgcttgtggtggacccgcaggagaaccgtaacaacaacaccaacaagagccgt
gcgccagaagcgctgcgcccgaccgcgcggccccgcgaaagcgcgcgcgaccccgacgcg
cggcgcgcctggcccggcagccctgagcgcgcccctggacgagagggcccgtatgggcgc
gagagcgagcctcagcagcgcgagcacgcgccgccccgcgagcacgcaccctgggacgcg
gacaccgagcgcgccaaagccggggacgcgccccgccgccacacgcaccgacctgtggcg
gagggcgagcctcgccgccaccgcgcccgccgccggcccggggacgaacccgacgacagg
ccagagcgcaggccacgtccccgcgacgccactaggccggcccgcgctgcagacggcgaa
ggcgacgatggggagcgcaagcggcgacaccgacacgggccgccggcccacgacgacagg
gagcgcagacaccgacgcagaaaagagaaccagggctctggggtccccgtgtctggtccc
aacttgtccaccaccaggccaatccagcaggacctgggccgccaggacctgccgctggct
gaggatcttgacaacatgaagaataacaagctggccaccggggaacctgccagtccccac
gacagcctgggccacagcggccttccccccagccccgccaaaatcgggaacagcaccaac
cctggtcccgccttggccaccaatccccagaacgctgccagccgcaggacgcccaacaat
ccgggcaacccgtccaaccccggcccccccaagactcccgagaacagccttatcgtcacc
aaccccagcagcacccagcccaactcagcgaagactgccaggaaacccgagcacatggcg
gtggagatccccccagcctgcccgcccctcaaccacaccgtggtccaagtaaacaaaaac
gccaacccagacccactgccaaagaaagaggaagagaagaaagaggaagaggaggcagac
cccggggaggacggcccaaagcccatgccgccctacagctccatgttcatcctctccacc
accaacccccttcgccggctgtgccattacatcctgaacctgcgctacttcgagatgtgc
atcctcatggtcattgccatgagcagcatcgctctggccgccgaggacccggtgcagccc
aacgcaccccgcaacaatgtgctgcgatattttgactatgtttttacaggcgtgtttacc
tttgagatggtgatcaagatgatcgacctgggcctcgtcttgcatcagggggcctatttc
cgtgacctatggaacattctggacttcatagtggtcagtggggccctggtggcctttgcc
ttcactggcaatagcaaaggaaaggacattaacaccattaagtctctccgagtcctccgg
gtgctacgacctctaaagaccatcaagcggctgccaaagctgaaggccgtgtttgactgc
gtggtgaactcgctcaagaacgtcttcaacatcctcattgtgtacatgctgttcatgttc
atcttcgctgtggtagccgtgcagctcttcaagggcaagttcttccactgcacggacgag
tccaaggagttcgagagagactgtcgaggcaagtacctcctgtacgagaagaacgaagtg
aaggcccgggaccgcgagtggaagaagtacgagttccactacgacaacgtgctctgggct
ctgctcacacttttcacagtgtccacaggagagggctggccacaggtcctcaagcactca
gtggatgctacttttgagaaccagggccccagccccgggtaccgcatggagatgtccatc
ttctacgtggtgtactttgtagtgtttcccttcttctttgtcaatatcttcgtggccttg
atcatcatcacctttcaggagcagggagacaagatgatggaagagtacagcctggagaaa
aatgagagggcctgcatcgactttgccatcagtgccaagccgctgaccaggcacatgccc
cagaacaagcagagcttccagtatcgaatgtggcagttcgtcgtgtccccaccctttgag
tacaccatcatggccatgatcgctctcaacaccatcgtgctaatgatgaagttctacgga
gcctcggtggcctatgaaaacgcccttcgcgtgttcaacattgtcttcacctccctcttc
tctctcgaatgtgtgctcaaagtcatggcttttgggattctgaattatttccgcgatgcc
tggaacatcttcgactttgtgactgttctgggcagcatcacagacatcctcgtcaccgag
tttgggaataacttcatcaacctgagctttctccgcctcttccgtgctgccagactcatc
aaactcctccgccagggttacaccatccgcattctcctctggactttcgtgcagtccttc
aaggccctaccttatgtctgtctgctgatcgccatgctcttcttcatctacgccatcatc
gggatgcaggtgtttggcaacatcggcattgacggggaagacgaggacagcgacgaggat
gaattccaaatcacggagcacaataacttccggaccttcttccaagcgctcatgcttctc
ttccggagcgccacaggagaagcgtggcacaacatcatgctctcctgcctcagcgggaag
ccgtgcgataagaactctgggatcctcacggcagactgcggcaacgagttcgcgtacttc
tactttgtctcgttcatcttcctgtgctcgtttctgatgctgaatctctttgtcgctgtc
atcatggacaacttcgagtacctcacccgagattcttccatcctgggcccccatcacttg
gatgaatacgtgcgtgtctgggcagagtatgaccctgctgcctgcggccgcattcactat
aaggacatgtacagtttattgcgagtaatatcgccccctctcggcttaggcaagaaatgt
cctcatagggttgcttgcaagagactcctgcggatggacctgccggtagcagatgacaac
acagttcacttcaactccaccctgatggctctgatccgaaccgcccttgatatcaaaatt
gccaagggtggagctgacaagcagcagatggatgcagagcttcgcaaggagatgatggcc
atttggcccaacctgtctcagaagaccctggatctgctggtcacacctcacaagtccacg
gacctgacagtgggtaagatctacgcagccatgatgatcatggagtattaccggcagagc
aaggccaagaaactgcaggccatgcgagaggagcagaaccggacaccactcatgttccag
cgcatggagcctccatcaccaacacaggagggaggacccagccagaatgcccttccctcc
actcagctggacccaggaggaggcctgatggctcacgaaggcggcatgaaggagagcccg
tcctgggtgacccagcgggcccaagagatgttccagaagactggcacctggagcccagag
cgagggccacccatcgacatgcctaacagccagcccaactcccagtctgtggagatgcga
gaaatgggtactgatggctactcagacagcgaacactacctccccatggaaggccagacc
agggccgcctccatgccccgcctcccagcagagaaccagaggagaaggggccggccacgt
ggaaatgacctcagtaccatctctgataccagccccatgaagcgctcagcctctgtgctg
ggacccaaagcccggcgactggatgactactcactagagcgggtaccgcctgaggagaac
caacggtaccaccaacgtcgccgggaccgtggccaccgcacctctgagcgctctctgggc
cgatacactgatgtggacacaggtttggggacagatctgagcatgaccacccaatcgggt
gacctgccctccaaagatcgggaccaggaccggggccgacccaaggaccggaagcatcgg
ccacaccaccaccaccaccaccatcatcatcatcccccggcccccgaccgggatcgctac
gcacaggagcggccggacaccggccgggcgcgggcccgggagcagcgctggtcccgctcg
cccagcgaaggtcgggagcacacgacacacagacagggcagtagttccgtcagtggaagc
ccagccccctctacgtccggcaccagcacgccgcggcgcggccgccgccagctcccccag
accccctgcaccccgcggccgcttgtgtcctactcgcccgctccgcgcaggcctgcggcg
cgcaggatggcgggtcccgcagcgccccctggcggctcgccgcggggttgccgccgtgcg
ccgcgctggcctgcgcatgcgcctgagggcccgcggccgcgcggtgccgactacaccgag
cccgacagcccgcgcgagccgccagggggcgcgcacgatcccgcgccgcggtcgcccagg
actccgcgcgccgcgggctgcgcgtcaccgcgccacggccgcaggctgcccaatggttac
tacgcggggcacggcgcgccgcggccgcgcacagcccgcaggggcgcgcacgacgcgtac
agcgagagcgaggacgactggtgctaa

KEGG   Mus musculus (house mouse): 12287
Entry
12287             CDS       T01002                                 
Symbol
Cacna1b, AW050276, AW060892, AW822256, BIII, Cav2.2, Cchn1a, alpha(1B)
Name
(RefSeq) calcium channel, voltage-dependent, N type, alpha 1B subunit
  KO
K04849  voltage-dependent calcium channel N type alpha-1B
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04010  MAPK signaling pathway
mmu04020  Calcium signaling pathway
mmu04721  Synaptic vesicle cycle
mmu04723  Retrograde endocannabinoid signaling
mmu04725  Cholinergic synapse
mmu04726  Serotonergic synapse
mmu04727  GABAergic synapse
mmu04728  Dopaminergic synapse
mmu04930  Type II diabetes mellitus
mmu05016  Huntington disease
mmu05020  Prion disease
mmu05022  Pathways of neurodegeneration - multiple diseases
mmu05032  Morphine addiction
mmu05033  Nicotine addiction
mmu05207  Chemical carcinogenesis - receptor activation
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    12287 (Cacna1b)
   04020 Calcium signaling pathway
    12287 (Cacna1b)
 09150 Organismal Systems
  09156 Nervous system
   04727 GABAergic synapse
    12287 (Cacna1b)
   04725 Cholinergic synapse
    12287 (Cacna1b)
   04728 Dopaminergic synapse
    12287 (Cacna1b)
   04726 Serotonergic synapse
    12287 (Cacna1b)
   04723 Retrograde endocannabinoid signaling
    12287 (Cacna1b)
   04721 Synaptic vesicle cycle
    12287 (Cacna1b)
 09160 Human Diseases
  09161 Cancer: overview
   05207 Chemical carcinogenesis - receptor activation
    12287 (Cacna1b)
  09164 Neurodegenerative disease
   05016 Huntington disease
    12287 (Cacna1b)
   05020 Prion disease
    12287 (Cacna1b)
   05022 Pathways of neurodegeneration - multiple diseases
    12287 (Cacna1b)
  09165 Substance dependence
   05032 Morphine addiction
    12287 (Cacna1b)
   05033 Nicotine addiction
    12287 (Cacna1b)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    12287 (Cacna1b)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mmu04040]
    12287 (Cacna1b)
Ion channels [BR:mmu04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   12287 (Cacna1b)
SSDB
Motif
Pfam: Ion_trans Ca_chan_IQ GPHH PKD_channel Ferlin_C
Other DBs
NCBI-GeneID: 12287
NCBI-ProteinID: NP_001035993
MGI: 88296
Ensembl: ENSMUSG00000004113
Vega: OTTMUSG00000012011
UniProt: O55017
Position
2:complement(24493872..24653210)
AA seq 2327 aa
MVRFGDELGGRYGGTGGGERARGGGAGGAGGPGQGGLPPGQRVLYKQSIAQRARTMALYN
PIPVKQNCFTVNRSLFVFSEDNVVRKYAKRITEWPPFEYMILATIIANCIVLALEQHLPD
GDKTPMSERLDDTEPYFIGIFCFEAGIKIIALGFVFHKGSYLRNGWNVMDFVVVLTGILA
TAGTDFDLRTLRAVRVLRPLKLVSGIPSLQVVLKSIMKAMVPLLQIGLLLFFAILMFAII
GLEFYMGKFHKACFPNSTDTEPVGDFPCGKDPPARQCDGDTECREYWPGPNFGITNFDNI
LFAILTVFQCITMEGWTDILYNTNDAAGNTWNWLYFIPLIIIGSFFMLNLVLGVLSGEFA
KERERVENRRAFLKLRRQQQIERELNGYLEWIFKAEEVMLAEEDKNAEEKSPLDVLKRAA
TKKSRNDLIHAEEGEDRFVDLCAVGSPFARASLKSGKTESSSYFRRKEKMFRFFIRRMVK
AQSFYWVVLCVVALNTLCVAMVHYNQPQRLTTALYFAEFVFLGLFLTEMSLKMYGLGPRS
YFRSSFNCFDFGVIVGSIFEVVWAAIKPGTSFGISVLRALRLLRIFKVTKYWNSLRNLVV
SLLNSMKSIISLLFLLFLFIVVFALLGMQLFGGQFNFQDETPTTNFDTFPAAILTVFQIL
TGEDWNAVMYHGIESQGGVSKGMFSSFYFIVLTLFGNYTLLNVFLAIAVDNLANAQELTK
DEEEMEEAANQKLALQKAKEVAEVSPMSAANISIAARQQNSAKARSVWEQRASQLRLQNL
RASCEALYSEMDPEERLRYASTRHVRPDMKTHMDRPLVVEPGRDGLRGPVGSKSKPEGTE
ATESADLPRRHHRHRDRDKTSATAPAGGEQDRTESTETGAREERARPRRSHSKETPGADT
QVRCERSRRHHRRGSPEEATEREPRRHRAHRHAQDSSKEGTAPVLVPKGERRARHRGPRT
GPREAENNEEPTRRHRARHKVPPTLQPPEREAAEKESNAVEGDKETRNHQPKEPHCDLEA
IAVTGVGPLHMLPSTCLQKVDEQPEDADNQRNVTRMGSQPSDPSTTVHVPVTLTGPPGET
PVVPSGNMNLEGQAEGKKEAEADDVLRRGPRPIVPYSSMFCLSPTNLLRRFCHYIVTMRY
FEMVILVVIALSSIALAAEDPVRTDSFRNNALKYMDYIFTGVFTFEMVIKMIDLGLLLHP
GAYFRDLWNILDFIVVSGALVAFAFSSFMGGSKGKDINTIKSLRVLRVLRPLKTIKRLPK
LKAVFDCVVNSLKNVLNILIVYMLFMFIFAVIAVQLFKGKFFYCTDESKELERDCRGQYL
DYEKEEVEAQPRQWKKYDFHYDNVLWALLTLFTVSTGEGWPMVLKHSVDATYEEQGPSPG
FRMELSIFYVVYFVVFPFFFVNIFVALIIITFQEQGDKVMSECSLEKNERACIDFAISAK
PLTRYMPQNKQSFQYKTWTFVVSPPFEYFIMAMIALNTVVLMMKFYDAPYEYELMLKCLN
IVFTSMFSMECILKIIAFGVLNYFRDAWNVFDFVTVLGSITDILVTEIANNFINLSFLRL
FRAARLIKLLRQGYTIRILLWTFVQSFKALPYVCLLIAMLFFIYAIIGMQVFGNIALDDD
TSINRHNNFRTFLQALMLLFRSATGEAWHEIMLSCLGNRACDPHANASECGSDFAYFYFV
SFIFLCSFLMLNLFVAVIMDNFEYLTRDSSILGPHHLDEFIRVWAEYDPAACGRISYNDM
FEMLKHMSPPLGLGKKCPARVAYKRLVRMNMPISNEDMTVHFTSTLMALIRTALEIKLAP
AGTKQHQCDAELRKEISSVWANLPQKTLDLLVPPHKPDEMTVGKVYAALMIFDFYKQNKT
TRDQTHQAPGGLSQMGPVSLFHPLKATLEQTQPAVLRGARVFLRQKSATSLSNGGAIQTQ
ESGIKESLSWGTQRTQDALYEARAPLERGHSAEIPVGQSGTLAVDVQMQNMTLRGPDGEP
QPGLESQGRAASMPRLAAETQPAPNASPMKRSISTLAPRPHGTQLCSTVLDRPPPSQASH
HHHHRCHRRRDKKQRSLEKGPSLSVDPEGAPSTAAGPGLPHGEGSTACRRDRKQERGRSQ
ERRQPSSSSSEKQRFYSCDRFGSREPPQLMPSLSSHPTSPTAALEPAPHPQGSGSVNGSP
LMSTSGASTPGRGGRRQLPQTPLTPRPSITYKTANSSPVHFAEGQSGLPAFSPGRLSRGL
SEHNALLQKEPLSQPLAPGSRIGSDPYLGQRLDSEASAHTLPEDTLTFEEAVATNSGRSS
RTSYVSSLTSQSHPLRRVPNGYHCTLGLSTGVRARHSYHHPDQDHWC
NT seq 6984 nt   +upstreamnt  +downstreamnt
atggtccgcttcggggacgagctaggcggccgctatgggggcaccggcggcggggagcgg
gctcggggtggcggggccggcggggcgggtggcccgggccaggggggtctgccgccgggc
cagcgggtcctgtacaagcagtccattgcgcagcgcgcacggactatggccctgtacaac
cccatcccagtcaagcagaactgcttcaccgtcaaccgctcgctcttcgtcttcagcgag
gacaacgtcgtccgcaaatacgctaagcgcatcaccgaatggccgcccttcgaatacatg
atcctggccaccatcatcgccaactgcattgttctggccctggagcagcacctccctgat
ggggacaagactcccatgtctgagcgactagatgacacggagccttacttcatcgggatc
ttttgcttcgaggcgggcatcaagatcatagccctgggctttgttttccacaagggctcc
taccttcggaacggctggaatgtcatggacttcgtggtggtcctcacggggattctcgcc
acagctggaactgactttgacctgcgcacactgagggctgtgcgtgtgcttaggcccctg
aagctggtgtctggaattccaagcttgcaggtggtgcttaagtccatcatgaaggccatg
gtcccgctgctgcagattgggctgctgctcttctttgccatcctcatgtttgccatcatc
ggcctcgaattctatatgggcaaattccataaggcctgtttccccaacagcacagataca
gagcctgtgggtgactttccctgtggcaaagatccccctgctcgtcagtgtgatggtgac
accgaatgccgggagtactggccaggacccaactttggcatcaccaattttgacaacatc
ctgtttgccatcttgacagtgttccagtgtatcaccatggagggctggactgacatcctc
tacaatacaaatgatgcggctggcaacacatggaactggttgtacttcatccccctcatc
atcattggctccttcttcatgctcaacctggtgctgggtgtgctttccggagagtttgcc
aaggagcgggagcgagtcgagaaccgccgcgccttcctgaagctccgcaggcagcagcag
attgagcgagagctgaatgggtacttggagtggatcttcaaggcagaggaagtcatgttg
gcagaggaggacaagaatgcagaagagaaatcccctttggatgtgttgaagagagctgcc
accaagaagagccgaaatgacctcatccatgcagaagagggggaggaccggtttgtagac
ctctgtgcagttgggtctccatttgctcgtgccagcctcaagagtgggaagacggagagc
tcatcgtacttccggagaaaggagaagatgttccggttctttatccggcgtatggtgaaa
gcacagagcttctactgggtggtactgtgtgtggtggccctgaacacactgtgtgtggcc
atggtgcactataatcagcctcagcggcttaccactgcactgtactttgcagagtttgtt
ttcctgggtctcttcctcacagagatgtccctgaagatgtatggcctagggcccagaagt
tacttcaggtcttccttcaactgctttgactttggggtgattgtggggagtatctttgaa
gtagtctgggctgccatcaagccaggaacctcctttggaatcagtgtgctgcgggctctg
cgactgctgaggatattcaaagttaccaagtattggaactctctgaggaacctggtggtt
tccctcctcaattccatgaagtccatcatcagccttctcttcctgcttttcctcttcatc
gtggtcttcgctctgttggggatgcagctgtttgggggacagttcaactttcaagatgag
actccaaccaccaattttgataccttcccagctgccatcctcactgtctttcagatcctg
acaggagaggattggaatgccgtaatgtatcatgggattgagtcgcaaggtggagtcagc
aaaggcatgttttcttccttttacttcatcgtcctgacactgtttggaaactacaccctg
ctgaatgtttttctggccattgctgtggacaaccttgccaatgcccaggagttgaccaag
gatgaagaggagatggaagaagcagccaatcagaaacttgctcttcagaaggccaaagaa
gtagctgaagtcagccccatgtctgctgccaatatctccatcgctgccaggcagcagaac
tcggccaaggcgcgctcagtatgggagcagcgggccagtcagctaaggctccagaatctg
cgtgccagctgtgaggcattgtacagtgagatggaccctgaggagcgcctgcgttatgcc
agcacgcgccatgtgaggccagacatgaagacacacatggaccgacccctagtggtggag
cctggtcgagatggcttgcggggacccgttgggagcaagtcaaagcctgaaggcacggag
gccacagaaagcgcggacctacctcgcaggcaccaccggcaccgtgatagggacaagacc
tcagccacagcacctgctggaggcgaacaggacaggacagaaagcaccgagaccggggcc
cgggaggaacgtgcgcgccctcgtcgaagtcacagcaaggagactccaggggctgacacg
caagtgcgctgtgagcgcagtagacgtcaccaccggcgcggctccccggaggaggccact
gaacgggagcctcggcgccaccgtgcccaccggcatgcacaggactcaagcaaggagggc
acggcgccggtgcttgtacccaagggtgagcgacgagcaagacaccgaggcccacgcacg
ggtccacgtgaggcagagaacaacgaggagcccacacgcaggcaccgtgcaaggcataag
gtgccacccacactgcagcccccagagagggaggctgcagagaaggagagcaacgcggtg
gaaggggataaggaaacccgaaatcaccagcccaaggaacctcactgtgacctggaggcc
attgcagttacaggtgtgggccctctgcacatgctgcccagcacctgtctccagaaagtg
gacgagcaaccagaggatgcagacaaccagcgtaatgtcacccggatgggcagtcagccc
tcagatcccagcaccactgtgcatgtcccagtgacactgacaggccctcctggggagacc
cctgtagttcccagtggtaacatgaacctggaaggccaagcagagggcaagaaggaggca
gaggcggatgatgtgctgagaagaggccccaggcccatcgttccctacagctccatgttt
tgtctcagccccaccaacctgcttcgtcgcttctgccattacattgtgaccatgcggtac
tttgagatggtaattcttgtggtcattgccttgagcagcattgccctggctgcagaggat
cctgtgcggacagattcattcaggaacaacgctttaaagtacatggattacatctttaca
ggagtcttcacctttgaaatggtcataaagatgatagacttgggcttgctgctgcaccct
ggtgcctacttccgggacctgtggaacattctggacttcattgttgtcagtggagccctg
gtggcatttgcgttctcgagcttcatgggaggatccaaagggaaagacatcaataccatc
aagtctctgagagtcctgcgtgtcctgaggcccctcaagaccatcaagcggctgcctaag
ctcaaggctgtctttgactgtgtggtgaactccctgaagaacgtcttgaacatcctgatt
gtctacatgctcttcatgttcatatttgccgtcattgccgtccagctcttcaaagggaag
ttcttttactgtactgatgaatccaaggagctggagagggactgccggggtcagtatttg
gattatgagaaggaagaagtagaagcccagccaaggcagtggaagaaatatgacttccac
tatgacaatgttctctgggccttgttgacgctgttcacagtgtccacgggagaggggtgg
cccatggtgctgaaacactctgtggatgccacctatgaggaacaggggcccagtcccggg
ttccggatggagctctccatcttctacgtggtctactttgtggtcttcccttttttcttt
gtcaacatctttgtggccttgatcattatcaccttccaggaacagggagataaggtgatg
tctgaatgcagcttagaaaagaatgagagggcttgcattgattttgccatcagtgccaag
cccctgacacggtacatgcctcaaaacaaacagtcgttccagtataagacatggacattc
gtggtctctccaccctttgagtacttcatcatggctatgatagccctcaacacagtggtg
ctgatgatgaagttctatgatgcaccttatgagtacgagctgatgctgaaatgcctgaac
attgtcttcacatccatgttctcgatggagtgcatactgaagatcatcgcctttggggta
ttgaactacttcagagatgcctggaacgtctttgactttgtcacggttttgggaagtatt
actgatattttagtaacagagatagcgaacaacttcatcaacctaagcttccttcgcctc
ttccgggcggcacggctgatcaagctgcttcgccagggctacaccatccgcatcctattg
tggaccttcgtccagtcctttaaggcgctgccctacgtgtgcctcctcattgccatgctg
ttcttcatctacgccatcatcggcatgcaggtttttggaaacattgcccttgatgatgac
accagtatcaaccgacacaacaacttccggacatttctgcaagccttaatgctattgttc
aggagtgccactggggaggcctggcatgagatcatgctgtcttgtctgggcaaccgggcc
tgtgacccacatgccaacgccagtgagtgcgggagcgactttgcctatttttattttgtc
tccttcatcttcctctgttcctttctgatgttgaacctctttgttgctgtaatcatggac
aattttgagtacctcactcgggactcttccatcctagggcctcaccacttagacgaattc
attcgagtctgggctgaatacgacccagctgcgtgtgggcgcatcagttacaatgacatg
tttgagatgctgaaacacatgtccccacctctggggttggggaagaaatgcccggctcga
gttgcatacaagcgcctggttcgcatgaacatgcccatatccaatgaggacatgacggtg
cactttacgtccacactgatggccctcatccggacagcactggagatcaagcttgcccca
gcggggacgaagcagcaccagtgtgatgctgagctgagaaaagagatctcttctgtgtgg
gctaatctgccccagaagactctggacttactggtaccaccccacaaacctgacgagatg
acagtggggaaggtctatgctgctctcatgatatttgacttctacaaacagaacaaaacc
accagagatcagactcaccaagctcccggaggcctgtcccagatgggtcccgtttccctg
ttccaccctctgaaggccaccctggaacagacacagcccgctgtgcttcgaggagctcgg
gttttccttcggcaaaagagtgcaacttccctcagcaatgggggtgccatacaaacccag
gaaagtggcatcaaggagtcgctgtcctggggcacgcagaggacccaagatgcactttat
gaggccagagcacctctagaacgtggccattctgcagagatccctgtggggcagtcagga
acactggctgtggatgtccagatgcagaacatgacactgagaggaccagatggggagccc
cagcctgggctggaaagccaaggcagagctgcctctatgccacgcctagcggcagaaaca
cagccggcccctaatgccagccccatgaagcgctccatctccacactggctccacgccca
catgggactcagctttgcagcacagttctggaccggcctcctcctagccaggcatcacat
caccaccaccaccgctgccaccggcgcagagacaagaagcaaaggtccctggaaaagggg
cccagcctgtctgttgacccagaaggtgcaccaagcactgctgcaggacctggtctgccc
catggagaaggatccaccgcctgccggcgggaccgtaaacaggagcgaggccggtcccag
gagcggaggcagccctcatcttcctcttcagagaagcagcgcttctattcctgtgaccgc
tttgggagccgggagcccccgcaactgatgccctcactcagtagccaccccacatcgcca
acagcggcgctagagccagcaccccacccacagggcagtggttccgttaatgggagcccc
ttgatgtcaacatccggtgctagcaccccgggccgaggtgggcggaggcagctcccccag
actcctctgaccccacgccccagcatcacctacaagaccgccaattcctcgcctgtccac
tttgctgagggtcagagcggcctcccagccttctcccctggccgtctcagccgcggcctt
tctgaacacaatgccctgctccagaaagagcccctgagccagcctctagctcctggctcc
cgaattggctctgacccttacctagggcagcgtctggacagtgaggcctccgcccacacc
ctgcctgaggatacactcacctttgaagaggcagtggccaccaactctggccgctcctcc
aggacttcctatgtgtcctccctcacttcccaatcccaccctctccgccgtgtacccaat
ggctatcactgcactttgggactcagcactggcgtccgggcgcggcacagctaccaccac
cccgatcaggaccactggtgctag

DBGET integrated database retrieval system