KEGG   Mus musculus (mouse): 12373
Entry
12373             CDS       T01002                                 

Symbol
Casq2, AA033488, AW146219, Csq2, ESTM52, cCSQ
Name
(RefSeq) calsequestrin 2
  KO
K23445  calsequestrin 2
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04020  Calcium signaling pathway
mmu04260  Cardiac muscle contraction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    12373 (Casq2)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    12373 (Casq2)
SSDB
Motif
Pfam: Calsequestrin Thioredoxin_6 Autophagy_act_C
Other DBs
NCBI-GeneID: 12373
NCBI-ProteinID: NP_033944
MGI: 1309469
Ensembl: ENSMUSG00000027861
Vega: OTTMUSG00000031087
UniProt: O09161
Position
3; 3 F2.2
AA seq 415 aa
MKRIYLLMVGVYLLSLSGAEEGLNFPTYDGKDRVVSLSEKNLKQMLKRYDLLCLYYHEPV
SSDKVSQKQFQLKEIVLELVAQVLEHKNIGFVMVDSRKEAKLAKRLGFSEEGSLYVLKGD
RTIEFDGEFAADVLVEFLLDLIEDPVEIVNNKLEVQAFERIEDQTKLLGFFKNEDSEYYK
AFQEAAEHFQPYIKFFATFDKAVAKKLSLKMNEVGFYEPFMDEPNVIPNKPYTEEELVEF
VKEHQRPTLRRLRPEDMFETWEDDLNGIHIVAFAEKSDPDGYEFLEILKQVARDNTDNPD
LSILWIDPDDFPLLVAYWEKTFKIDLFKPQIGVVNVTDADSIWMEIPDDDDLPTAEELED
WIEDVLSGKINTEDDDNEDEDDDGDDNDDDDDDDDDNDNSDEDNEDSDDDDDDDE
NT seq 1248 nt   +upstreamnt  +downstreamnt
atgaagaggatttacctgctcatggtgggggtttatctgctgtccctgagcggggcagaa
gaggggctgaacttccccacgtacgatgggaaagaccgagtggtcagcctttctgagaag
aacctcaagcagatgttgaagagatatgatttgctctgtctctattaccacgaacctgtg
tcttcagacaaggtctcacaaaaacagttccagctgaaggagattgtactggagcttgtg
gcccaggtcctggaacataaaaacataggctttgtgatggtggattcgaggaaagaggcc
aagcttgctaagaggctgggattcagtgaagaaggaagcctgtatgttctgaagggtgac
cgcacgattgagtttgacggggagttcgcagcagatgtcttagtggaatttctcttggat
ctcattgaagacccagtggagatcgtgaataacaagctggaggtccaggcctttgagcgc
atcgaggaccagaccaagctccttggcttcttcaagaatgaggactcagaatattacaaa
gcattccaagaggcagctgaacacttccagccttacatcaagttctttgccacctttgac
aaggcggtggcaaagaagttatccttgaagatgaacgaagttggcttctatgagccattt
atggatgagcccaacgtcatccctaacaaaccgtacacagaagaggagcttgtggagttt
gtgaaggaacatcaaagacccaccctacgtcgcttgcgcccagaggacatgtttgaaaca
tgggaagacgacttgaatgggatccacatcgtggcctttgcggagaagagtgacccagat
ggctatgagttcctagagatcctgaaacaggttgcccgggacaacactgacaatcctgac
ttgagcatcttgtggattgacccagatgactttccactgcttgttgcttactgggagaag
actttcaagattgacctgttcaagccacagattggggtggtgaatgtaaccgatgctgac
agtatctggatggagatcccagatgatgacgacctgcccacagctgaggagctggaagac
tggattgaagatgtgctttctggaaagatcaacactgaagatgatgacaatgaagatgaa
gatgatgatggtgatgacaacgatgacgatgatgatgacgacgatgataatgataattct
gatgaggataatgaagacagtgatgatgacgatgatgacgatgaatag

DBGET integrated database retrieval system