KEGG   Mus musculus (mouse): 12519
Entry
12519             CDS       T01002                                 

Gene name
Cd80, B71, Cd28, Cd28l, Ly-5, Ly-53, Ly5, Ly53, MIC17, TSA1
Definition
(RefSeq) CD80 antigen
  KO
K05412  CD80 antigen
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04514  Cell adhesion molecules
mmu04620  Toll-like receptor signaling pathway
mmu04672  Intestinal immune network for IgA production
mmu04940  Type I diabetes mellitus
mmu05320  Autoimmune thyroid disease
mmu05322  Systemic lupus erythematosus
mmu05323  Rheumatoid arthritis
mmu05330  Allograft rejection
mmu05332  Graft-versus-host disease
mmu05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    12519 (Cd80)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    12519 (Cd80)
   04672 Intestinal immune network for IgA production
    12519 (Cd80)
 09160 Human Diseases
  09163 Immune disease
   05322 Systemic lupus erythematosus
    12519 (Cd80)
   05323 Rheumatoid arthritis
    12519 (Cd80)
   05320 Autoimmune thyroid disease
    12519 (Cd80)
   05330 Allograft rejection
    12519 (Cd80)
   05332 Graft-versus-host disease
    12519 (Cd80)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    12519 (Cd80)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    12519 (Cd80)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mmu04090]
    12519 (Cd80)
CD molecules [BR:mmu04090]
 Proteins
  12519 (Cd80)
SSDB
Motif
Pfam: C2-set_2 Ig_3 V-set ig I-set Ig_2 Protocadherin EphA2_TM
Other DBs
NCBI-GeneID: 12519
NCBI-ProteinID: NP_033985
MGI: 101775
Ensembl: ENSMUSG00000075122
UniProt: Q00609 Q549R2
Structure
PDB: 
4RWH

Position
16 B4; 16 26.86 cM
AA seq 306 aa
MACNCQLMQDTPLLKFPCPRLILLFVLLIRLSQVSSDVDEQLSKSVKDKVLLPCRYNSPH
EDESEDRIYWQKHDKVVLSVIAGKLKVWPEYKNRTLYDNTTYSLIILGLVLSDRGTYSCV
VQKKERGTYEVKHLALVKLSIKADFSTPNITESGNPSADTKRITCFASGGFPKPRFSWLE
NGRELPGINTTISQDPESELYTISSQLDFNTTRNHTIKCLIKYGDAHVSEDFTWEKPPED
PPDSKNTLVLFGAGFGAVITVVVIVVIIKCFCKHRSCFRRNEASRETNNSLTFGPEEALA
EQTVFL
NT seq 921 nt   +upstreamnt  +downstreamnt
atggcttgcaattgtcagttgatgcaggatacaccactcctcaagtttccatgtccaagg
ctcattcttctctttgtgctgctgattcgtctttcacaagtgtcttcagatgttgatgaa
caactgtccaagtcagtgaaagataaggtattgctgccttgccgttacaactctcctcat
gaagatgagtctgaagaccgaatctactggcaaaaacatgacaaagtggtgctgtctgtc
attgctgggaaactaaaagtgtggcccgagtataagaaccggactttatatgacaacact
acctactctcttatcatcctgggcctggtcctttcagaccggggcacatacagctgtgtc
gttcaaaagaaggaaagaggaacgtatgaagttaaacacttggctttagtaaagttgtcc
atcaaagctgacttctctacccccaacataactgagtctggaaacccatctgcagacact
aaaaggattacctgctttgcttccgggggtttcccaaagcctcgcttctcttggttggaa
aatggaagagaattacctggcatcaatacgacaatttcccaggatcctgaatctgaattg
tacaccattagtagccaactagatttcaatacgactcgcaaccacaccattaagtgtctc
attaaatatggagatgctcacgtgtcagaggacttcacctgggaaaaacccccagaagac
cctcctgatagcaagaacacacttgtgctctttggggcaggattcggcgcagtaataaca
gtcgtcgtcatcgttgtcatcatcaaatgcttctgtaagcacagaagctgtttcagaaga
aatgaggcaagcagagaaacaaacaacagccttaccttcgggcctgaagaagcattagct
gaacagaccgtcttcctttag

KEGG   Mus musculus (mouse): 12524
Entry
12524             CDS       T01002                                 

Gene name
Cd86, B7, B7-2, B7.2, B70, CLS1, Cd28l, Cd28l2, ETC-1, Ly-5, Ly-58, Ly5, Ly58, MB7, MB7-2, TS/A-2
Definition
(RefSeq) CD86 antigen
  KO
K05413  CD86 antigen
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04514  Cell adhesion molecules
mmu04620  Toll-like receptor signaling pathway
mmu04672  Intestinal immune network for IgA production
mmu04940  Type I diabetes mellitus
mmu05167  Kaposi sarcoma-associated herpesvirus infection
mmu05202  Transcriptional misregulation in cancer
mmu05320  Autoimmune thyroid disease
mmu05322  Systemic lupus erythematosus
mmu05323  Rheumatoid arthritis
mmu05330  Allograft rejection
mmu05332  Graft-versus-host disease
mmu05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    12524 (Cd86)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    12524 (Cd86)
   04672 Intestinal immune network for IgA production
    12524 (Cd86)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    12524 (Cd86)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    12524 (Cd86)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    12524 (Cd86)
   05323 Rheumatoid arthritis
    12524 (Cd86)
   05320 Autoimmune thyroid disease
    12524 (Cd86)
   05330 Allograft rejection
    12524 (Cd86)
   05332 Graft-versus-host disease
    12524 (Cd86)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    12524 (Cd86)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    12524 (Cd86)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    12524 (Cd86)
   04090 CD molecules [BR:mmu04090]
    12524 (Cd86)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   12524 (Cd86)
CD molecules [BR:mmu04090]
 Proteins
  12524 (Cd86)
SSDB
Motif
Pfam: V-set Ig_3 I-set V-set_CD47 C2-set_2 DUF1080
Other DBs
NCBI-GeneID: 12524
NCBI-ProteinID: NP_062261
MGI: 101773
Ensembl: ENSMUSG00000022901
Vega: OTTMUSG00000028661
UniProt: P42082 Q549Q9
Position
16 B3; 16 25.72 cM
AA seq 309 aa
MDPRCTMGLAILIFVTVLLISDAVSVETQAYFNGTAYLPCPFTKAQNISLSELVVFWQDQ
QKLVLYEHYLGTEKLDSVNAKYLGRTSFDRNNWTLRLHNVQIKDMGSYDCFIQKKPPTGS
IILQQTLTELSVIANFSEPEIKLAQNVTGNSGINLTCTSKQGHPKPKKMYFLITNSTNEY
GDNMQISQDNVTELFSISNSLSLSFPDGVWHMTVVCVLETESMKISSKPLNFTQEFPSPQ
TYWKEITASVTVALLLVMLLIIVCHKKPNQPSRPSNTASKLERDSNADRETINLKELEPQ
IASAKPNAE
NT seq 930 nt   +upstreamnt  +downstreamnt
atggaccccagatgcaccatgggcttggcaatccttatctttgtgacagtcttgctgatc
tcagatgctgtttccgtggagacgcaagcttatttcaatgggactgcatatctgccgtgc
ccatttacaaaggctcaaaacataagcctgagtgagctggtagtattttggcaggaccag
caaaagttggttctgtacgagcactatttgggcacagagaaacttgatagtgtgaatgcc
aagtacctgggccgcacgagctttgacaggaacaactggactctacgacttcacaatgtt
cagatcaaggacatgggctcgtatgattgttttatacaaaaaaagccacccacaggatca
attatcctccaacagacattaacagaactgtcagtgatcgccaacttcagtgaacctgaa
ataaaactggctcagaatgtaacaggaaattctggcataaatttgacctgcacgtctaag
caaggtcacccgaaacctaagaagatgtattttctgataactaattcaactaatgagtat
ggtgataacatgcagatatcacaagataatgtcacagaactgttcagtatctccaacagc
ctctctctttcattcccggatggtgtgtggcatatgaccgttgtgtgtgttctggaaacg
gagtcaatgaagatttcctccaaacctctcaatttcactcaagagtttccatctcctcaa
acgtattggaaggagattacagcttcagttactgtggccctcctccttgtgatgctgctc
atcattgtatgtcacaagaagccgaatcagcctagcaggcccagcaacacagcctctaag
ttagagcgggatagtaacgctgacagagagactatcaacctgaaggaacttgaaccccaa
attgcttcagcaaaaccaaatgcagagtga

DBGET integrated database retrieval system