KEGG   Mus musculus (mouse): 12540
Entry
12540             CDS       T01002                                 

Symbol
Cdc42, AI747189, AU018915
Name
(RefSeq) cell division cycle 42
  KO
K04393  cell division control protein 42
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04010  MAPK signaling pathway
mmu04014  Ras signaling pathway
mmu04015  Rap1 signaling pathway
mmu04062  Chemokine signaling pathway
mmu04144  Endocytosis
mmu04360  Axon guidance
mmu04370  VEGF signaling pathway
mmu04510  Focal adhesion
mmu04520  Adherens junction
mmu04530  Tight junction
mmu04660  T cell receptor signaling pathway
mmu04666  Fc gamma R-mediated phagocytosis
mmu04670  Leukocyte transendothelial migration
mmu04722  Neurotrophin signaling pathway
mmu04810  Regulation of actin cytoskeleton
mmu04912  GnRH signaling pathway
mmu04932  Non-alcoholic fatty liver disease
mmu04933  AGE-RAGE signaling pathway in diabetic complications
mmu05100  Bacterial invasion of epithelial cells
mmu05132  Salmonella infection
mmu05135  Yersinia infection
mmu05165  Human papillomavirus infection
mmu05200  Pathways in cancer
mmu05203  Viral carcinogenesis
mmu05205  Proteoglycans in cancer
mmu05211  Renal cell carcinoma
mmu05212  Pancreatic cancer
mmu05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    12540 (Cdc42)
   04014 Ras signaling pathway
    12540 (Cdc42)
   04015 Rap1 signaling pathway
    12540 (Cdc42)
   04370 VEGF signaling pathway
    12540 (Cdc42)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    12540 (Cdc42)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    12540 (Cdc42)
   04520 Adherens junction
    12540 (Cdc42)
   04530 Tight junction
    12540 (Cdc42)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    12540 (Cdc42)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    12540 (Cdc42)
   04666 Fc gamma R-mediated phagocytosis
    12540 (Cdc42)
   04670 Leukocyte transendothelial migration
    12540 (Cdc42)
   04062 Chemokine signaling pathway
    12540 (Cdc42)
  09152 Endocrine system
   04912 GnRH signaling pathway
    12540 (Cdc42)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    12540 (Cdc42)
  09158 Development and regeneration
   04360 Axon guidance
    12540 (Cdc42)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    12540 (Cdc42)
   05205 Proteoglycans in cancer
    12540 (Cdc42)
   05203 Viral carcinogenesis
    12540 (Cdc42)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    12540 (Cdc42)
   05211 Renal cell carcinoma
    12540 (Cdc42)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    12540 (Cdc42)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    12540 (Cdc42)
   05135 Yersinia infection
    12540 (Cdc42)
   05100 Bacterial invasion of epithelial cells
    12540 (Cdc42)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    12540 (Cdc42)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    12540 (Cdc42)
   04933 AGE-RAGE signaling pathway in diabetic complications
    12540 (Cdc42)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    12540 (Cdc42)
   03036 Chromosome and associated proteins [BR:mmu03036]
    12540 (Cdc42)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    12540 (Cdc42)
   04031 GTP-binding proteins [BR:mmu04031]
    12540 (Cdc42)
Membrane trafficking [BR:mmu04131]
 Exocytosis
  Small GTPases and associated proteins
   Rho GTPases
    12540 (Cdc42)
 Endocytosis
  Lipid raft mediated endocytosis
   GRAF1-dependent endocytosis
    12540 (Cdc42)
  Macropinocytosis
   Ras GTPases
    12540 (Cdc42)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    12540 (Cdc42)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of microglial cells
   12540 (Cdc42)
  Exosomal proteins of breast milk
   12540 (Cdc42)
GTP-binding proteins [BR:mmu04031]
 Small (monomeric) G-proteins
  Rho Family
   Rac/Cdc42 [OT]
    12540 (Cdc42)
SSDB
Motif
Pfam: Ras Roc Arf PET117 GTP_EFTU
Other DBs
NCBI-GeneID: 12540
NCBI-ProteinID: NP_001230698
MGI: 106211
Ensembl: ENSMUSG00000006699
Vega: OTTMUSG00000009829
UniProt: P60766
Structure
PDB: 
5C2J 3EG5

Position
4 D3; 4 69.83 cM
AA seq 191 aa
MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAG
QEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLR
DDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQRGLKNVFDEAILAALEPP
ETQPKRKCCIF
NT seq 576 nt   +upstreamnt  +downstreamnt
atgcagacaattaagtgtgttgttgttggtgatggtgctgttggtaaaacatgtctcctg
atatcctacacaacaaacaaattcccatcggaatatgtaccaactgtttttgacaactat
gcagtcacagttatgattggtggagagccatacactcttggactttttgatactgcaggg
caagaggattatgacagactacgaccgctaagttatccacagacagatgtttttctagta
tgtttctcagtggtctctccatcctcatttgaaaatgtgaaagaaaagtgggtgcctgag
ataactcaccactgtccaaagactcctttcttgcttgttgggacccaaattgatctcaga
gatgacccctctactattgagaaacttgccaagaacaaacagaagcctattactccagag
actgctgaaaagctggcgcgggatctgaaggctgtcaagtatgtggagtgctctgccctc
acacagagaggtctgaagaatgtgtttgatgaggctatcctagctgccctcgagcctccg
gaaactcaacccaaaaggaagtgctgtatattctaa

DBGET integrated database retrieval system