KEGG   Mus musculus (mouse): 12631
Entry
12631             CDS       T01002                                 

Symbol
Cfl1, AA959946, Cof
Name
(RefSeq) cofilin 1, non-muscle
  KO
K05765  cofilin
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04360  Axon guidance
mmu04666  Fc gamma R-mediated phagocytosis
mmu04810  Regulation of actin cytoskeleton
mmu05133  Pertussis
mmu05170  Human immunodeficiency virus 1 infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    12631 (Cfl1)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    12631 (Cfl1)
  09158 Development and regeneration
   04360 Axon guidance
    12631 (Cfl1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    12631 (Cfl1)
  09171 Infectious disease: bacterial
   05133 Pertussis
    12631 (Cfl1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    12631 (Cfl1)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mmu04812]
    12631 (Cfl1)
   04147 Exosome [BR:mmu04147]
    12631 (Cfl1)
Membrane trafficking [BR:mmu04131]
 Others
  Actin-binding proteins
   Others
    12631 (Cfl1)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    ADF / Cofilin
     12631 (Cfl1)
Exosome [BR:mmu04147]
 Exosomal proteins
  Proteins found in most exosomes
   12631 (Cfl1)
SSDB
Motif
Pfam: Cofilin_ADF
Other DBs
NCBI-GeneID: 12631
NCBI-ProteinID: NP_031713
MGI: 101757
Ensembl: ENSMUSG00000056201
Vega: OTTMUSG00000060221
UniProt: P18760 Q544Y7
Position
19; 19 A
AA seq 166 aa
MASGVAVSDGVIKVFNDMKVRKSSTPEEVKKRKKAVLFCLSEDKKNIILEEGKEILVGDV
GQTVDDPYTTFVKMLPDKDCRYALYDATYETKESKKEDLVFIFWAPENAPLKSKMIYASS
KDAIKKKLTGIKHELQANCYEEVKDRCTLAEKLGGSAVISLEGKPL
NT seq 501 nt   +upstreamnt  +downstreamnt
atggcctctggtgtggctgtctctgatggtgtcatcaaggtgttcaatgacatgaaggtt
cgcaagtcttcaacaccagaagaagtgaagaaacgcaagaaggcggtgctcttttgcctg
agtgaggacaagaagaacatcatcctggaggagggcaaggagatcctggtaggagatgtg
gggcagactgtggacgacccctacaccacttttgtcaagatgctgccagacaaggactgc
cgctatgcactctatgatgcaacctatgagaccaaggagagcaagaaggaggacctggtg
ttcatcttctgggcccccgagaatgcacccctcaagagcaaaatgatctatgccagctcc
aaggatgccatcaagaagaagctgacaggaatcaagcatgaattacaagctaactgctac
gaggaggtcaaggaccgctgcaccctggcagagaaactaggtggcagcgccgtcatttcc
ctggagggcaagcctttgtga

KEGG   Mus musculus (mouse): 12632
Entry
12632             CDS       T01002                                 

Symbol
Cfl2
Name
(RefSeq) cofilin 2, muscle
  KO
K05765  cofilin
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04360  Axon guidance
mmu04666  Fc gamma R-mediated phagocytosis
mmu04810  Regulation of actin cytoskeleton
mmu05133  Pertussis
mmu05170  Human immunodeficiency virus 1 infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    12632 (Cfl2)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    12632 (Cfl2)
  09158 Development and regeneration
   04360 Axon guidance
    12632 (Cfl2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    12632 (Cfl2)
  09171 Infectious disease: bacterial
   05133 Pertussis
    12632 (Cfl2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    12632 (Cfl2)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mmu04812]
    12632 (Cfl2)
   04147 Exosome [BR:mmu04147]
    12632 (Cfl2)
Membrane trafficking [BR:mmu04131]
 Others
  Actin-binding proteins
   Others
    12632 (Cfl2)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    ADF / Cofilin
     12632 (Cfl2)
Exosome [BR:mmu04147]
 Exosomal proteins
  Proteins found in most exosomes
   12632 (Cfl2)
SSDB
Motif
Pfam: Cofilin_ADF Ribosomal_S2
Other DBs
NCBI-GeneID: 12632
NCBI-ProteinID: NP_031714
MGI: 101763
Ensembl: ENSMUSG00000062929
UniProt: P45591 Q3UHW9
Position
12; 12 C1
AA seq 166 aa
MASGVTVNDEVIKVFNDMKVRKSSTQEEIKKRKKAVLFCLSDDKRQIIVEEAKQILVGDI
GDTVEDPYTSFVKLLPLNDCRYALYDATYETKESKKEDLVFIFWAPESAPLKSKMIYASS
KDAIKKKFTGIKHEWQVNGLDDIKDRSTLGEKLGGSVVVSLEGKPL
NT seq 501 nt   +upstreamnt  +downstreamnt
atggcatctggagttacagtgaatgatgaagtcatcaaagtttttaatgatatgaaagta
agaaaatcttctacacaggaggagatcaaaaaaagaaagaaagcagttctcttctgtttg
agcgatgacaaaagacaaataattgtagaggaagccaagcagatcttggtgggtgacatt
ggtgacactgtagaggacccctacacatcttttgtgaagttgttgcctctgaatgattgc
cgatatgctttgtacgatgccacgtacgaaacaaaagagtctaagaaagaagacctagta
tttatattctgggctcctgaaagtgcaccgttaaaaagcaagatgatttatgctagctct
aaagatgccattaaaaagaaatttacaggtattaaacatgagtggcaagtaaatggcttg
gacgatattaaggaccgctcgacgctgggagagaaactggggggcagtgttgtagtttcc
cttgaaggaaagccactataa

DBGET integrated database retrieval system