KEGG   Mus musculus (house mouse): 12889
Entry
12889             CDS       T01002                                 
Symbol
Cplx1, 921-S
Name
(RefSeq) complexin 1
  KO
K15294  complexin-1/2
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04721  Synaptic vesicle cycle
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09156 Nervous system
   04721 Synaptic vesicle cycle
    12889 (Cplx1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    12889 (Cplx1)
Membrane trafficking [BR:mmu04131]
 SNARE
  SNARE associated proteins
   Syntaxin-binding proteins
    12889 (Cplx1)
SSDB
Motif
Pfam: Synaphin
Other DBs
NCBI-GeneID: 12889
NCBI-ProteinID: NP_031782
MGI: 104727
Ensembl: ENSMUSG00000033615
Vega: OTTMUSG00000028893
UniProt: P63040
Position
5:complement(108666420..108697893)
AA seq 134 aa
MEFVMKQALGGATKDMGKMLGGDEEKDPDAAKKEEERQEALRQAEEERKAKYAKMEAERE
VMRQGIRDKYGIKKKEEREAEAQAAMEANSEGSLTRPKKAIPPGCGDEPEEEDESILDTV
IKYLPGPLQDMFKK
NT seq 405 nt   +upstreamnt  +downstreamnt
atggagttcgtgatgaaacaagccctgggaggggccaccaaggacatggggaagatgctt
gggggtgatgaggaaaaggaccccgatgctgctaagaaggaggaagagcggcaggaggca
ctgcggcaggcagaggaggagcgcaaagcaaagtacgccaagatggaggcagaacgtgag
gtcatgcggcagggtataagagacaagtatggcatcaagaagaaggaggagcgtgaggct
gaggctcaggcagccatggaggccaactcggaaggcagcctgactcgacccaagaaggct
atcccaccgggctgtggcgatgagccagaggaggaagatgagagcatcctggacactgtc
atcaagtacctgcctgggccactgcaggacatgttcaagaagtaa

KEGG   Mus musculus (house mouse): 12890
Entry
12890             CDS       T01002                                 
Symbol
Cplx2, 921-L, AI413745, AW492120, Gm34843
Name
(RefSeq) complexin 2
  KO
K15294  complexin-1/2
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04721  Synaptic vesicle cycle
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09156 Nervous system
   04721 Synaptic vesicle cycle
    12890 (Cplx2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    12890 (Cplx2)
Membrane trafficking [BR:mmu04131]
 SNARE
  SNARE associated proteins
   Syntaxin-binding proteins
    12890 (Cplx2)
SSDB
Motif
Pfam: Synaphin Spt5_N
Other DBs
NCBI-GeneID: 12890
NCBI-ProteinID: NP_034076
MGI: 104726
Ensembl: ENSMUSG00000025867
Vega: OTTMUSG00000032656
UniProt: P84086
Position
13:54455447..54531736
AA seq 134 aa
MDFVMKQALGGATKDMGKMLGGEEEKDPDAQKKEEERQEALRQQEEERKAKHARMEAERE
KVRQQIRDKYGLKKKEEKEAEEKAALEQPCEGSLTRPKKAIPAGCGDEEEEEEESILDTV
LKYLPGPLQDMFKK
NT seq 405 nt   +upstreamnt  +downstreamnt
atggacttcgtcatgaagcaagccctcggaggggccaccaaggacatggggaagatgctg
gggggagaggaggagaaggacccagacgcacagaagaaggaggaggagcggcaggaggcc
ctgaggcagcaggaggaagagcgcaaggcgaaacacgcccgcatggaagccgagcgcgag
aaggtccggcagcagatccgagacaagtatgggctgaagaagaaggaagagaaagaggca
gaggagaaggcagccctggaacagccctgcgagggaagcctgacccgacccaagaaggcc
atccctgcaggctgtggggacgaggaggaggaggaagaggagagcatcctggacacagtg
ctcaaatatctgccagggccgctgcaggacatgttcaagaagtaa

KEGG   Mus musculus (house mouse): 225644
Entry
225644            CDS       T01002                                 
Symbol
Cplx4, A930004D23Rik, CPXIV, Gm957
Name
(RefSeq) complexin 4
  KO
K15295  complexin-3/4
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04721  Synaptic vesicle cycle
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09156 Nervous system
   04721 Synaptic vesicle cycle
    225644 (Cplx4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    225644 (Cplx4)
Membrane trafficking [BR:mmu04131]
 SNARE
  SNARE associated proteins
   Syntaxin-binding proteins
    225644 (Cplx4)
SSDB
Motif
Pfam: Synaphin
Other DBs
NCBI-GeneID: 225644
NCBI-ProteinID: NP_663468
MGI: 2685803
Ensembl: ENSMUSG00000024519
UniProt: Q80WM3
Position
18:complement(66088793..66103249)
AA seq 160 aa
MAFFVKNMISNQVKNLGFGGGSEEKKEEGGTSDPAAAKGMTREEYEEYQKQMIEEKMERD
AAFTQKKAERACLRVHLRDKYRLPKSEMDETQIQLAGDDVDLPEDLRKMVDEDQDEEEEK
DSILGQLQNLQNMDLDTIKEKAQATFTEIKQSAEQKCSVM
NT seq 483 nt   +upstreamnt  +downstreamnt
atggctttctttgtgaaaaatatgataagtaaccaggtaaagaatttaggatttggaggt
gggtctgaagaaaagaaagaagaaggaggcacctcagaccccgcggcggctaaagggatg
actagagaggaatacgaggaataccagaagcagatgattgaagagaagatggagagagat
gccgcatttacgcagaaaaaggcagagagggcgtgcctacgagtccacctcagggacaag
tacaggcttccaaagagtgaaatggatgagacacaaatccaactggctggagacgatgtg
gacttaccagaagatctccgaaagatggtagatgaagaccaagatgaggaagaggagaag
gattctatccttgggcagctgcagaacctccaaaacatggacttggataccattaaagaa
aaggcacaagccaccttcacagaaatcaagcagtcagcagagcagaagtgttctgtgatg
tga

KEGG   Mus musculus (house mouse): 235415
Entry
235415            CDS       T01002                                 
Symbol
Cplx3, BC016632, CpxIII, ERGIC-53L, ERGL, Lamn1l, Lman1l
Name
(RefSeq) complexin 3
  KO
K15295  complexin-3/4
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04721  Synaptic vesicle cycle
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09156 Nervous system
   04721 Synaptic vesicle cycle
    235415 (Cplx3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    235415 (Cplx3)
Membrane trafficking [BR:mmu04131]
 SNARE
  SNARE associated proteins
   Syntaxin-binding proteins
    235415 (Cplx3)
SSDB
Motif
Pfam: Synaphin
Other DBs
NCBI-GeneID: 235415
NCBI-ProteinID: NP_666335
MGI: 2384571
Ensembl: ENSMUSG00000039714
Vega: OTTMUSG00000063202
UniProt: Q8R1B5
Position
9:complement(57507275..57513564)
AA seq 158 aa
MAFMVKSMVGGQLKNLTGSLGGGEDKGDGDKSAAEAQGMSREEYEEYQKQLVEEKMERDA
QFTQRKAERATLRSHFRDKYRLPKNETDESQIQLAGGDVELPRELAKMIEEDTEEEEDKA
SVLGQLASLPGLDLSSLKDKAQTTLGDLKQSAEKCHIM
NT seq 477 nt   +upstreamnt  +downstreamnt
atggcgttcatggtgaagtccatggtgggtggccaactgaagaacctcacagggagcctg
gggggcggcgaggacaagggggacggagacaagtctgcagccgaagcacagggcatgagc
cgagaagagtacgaggagtatcagaagcaactggtggaggagaagatggagcgagatgca
cagttcacacagaggaaggcagagcgggccacactgcgaagtcacttcagagacaaatac
cgtctgcccaagaacgaaacagatgaaagccagatccagctggcaggcggagatgtggag
ctgcctcgggagctagccaagatgatcgaggaggatacggaggaagaggaggataaggcc
tctgtgctcgggcagctggccagcctccctggcctagacctcagctcactcaaggacaaa
gcccagactacactaggggacctcaagcaatcagctgagaagtgccatatcatgtga

DBGET integrated database retrieval system