KEGG   Mus musculus (mouse): 13163
Entry
13163             CDS       T01002                                 

Gene name
Daxx
Definition
(RefSeq) Fas death domain-associated protein
  KO
K02308  death-associated protein 6
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04010  MAPK signaling pathway
mmu04210  Apoptosis
mmu05012  Parkinson disease
mmu05014  Amyotrophic lateral sclerosis
mmu05022  Pathways of neurodegeneration - multiple diseases
mmu05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    13163 (Daxx)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    13163 (Daxx)
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    13163 (Daxx)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    13163 (Daxx)
   05014 Amyotrophic lateral sclerosis
    13163 (Daxx)
   05022 Pathways of neurodegeneration - multiple diseases
    13163 (Daxx)
SSDB
Motif
Pfam: Daxx PPP4R2 CDC45 BUD22 Nop14 SDA1
Other DBs
NCBI-GeneID: 13163
NCBI-ProteinID: NP_001186662
MGI: 1197015
Ensembl: ENSMUSG00000002307
Vega: OTTMUSG00000037068
UniProt: O35613 Q3UKR0
Position
17 B1; 17 17.98 cM
AA seq 740 aa
MATDDSIIVLDDDDEDEAAAQPGPSNLPPNPASTGPGPGLSQQATGLSEPRVDGGSSNSG
SRKCYKLDNEKLFEEFLELCKTETSDHPEVVPFLHKLQQRAQSVFLASAEFCNILSRVLA
RSRKRPAKIYVYINELCTVLKAHSIKKKLNLAPAASTTSEASGPNPPTEPPSDLTNTENT
ASEASRTRGSRRQIQRLEQLLALYVAEIRRLQEKELDLSELDDPDSSYLQEARLKRKLIR
LFGRLCELKDCSSLTGRVIEQRIPYRGTRYPEVNRRIERLINKPGLDTFPDYGDVLRAVE
KAATRHSLGLPRQQLQLLAQDAFRDVGVRLQERRHLDLIYNFGCHLTDDYRPGVDPALSD
PTLARRLRENRTLAMNRLDEVISKYAMMQDKTEEGERQKRRARLLGTAPQPSDPPKASSE
SGEGPSGMASQECPTTSKAETDDDDDDDDDDDDEDNEESEEEEEEEEEEKEATEDEDEDL
EQLQEDQGGDEEEEGGDNEGNESPTSPSDFFHRRNSEPAEGLRTPEGQQKRGLTETPASP
PGASLDPPSTDAESSGEQLLEPLLGDESPVSQLAELEMEALPEERDISSSRKKSEDSLPT
ILENGAAVVTSTSVNGRVSSHTWRDASPPSKRFRKEKKQLGSGLLGNSYIKEPMAQQDSG
QNTSVQPMPSPPLASVASVADSSTRVDSPSHELVTSSLCSPSPSLLLQTPQAQSLRQCIY
KTSVATQCDPEEIIVLSDSD
NT seq 2223 nt   +upstreamnt  +downstreamnt
atggccaccgatgacagcatcattgtacttgatgatgacgatgaagatgaagctgctgct
caaccagggccctccaacctaccccccaatcctgcctcaacaggacctggtcctggcctg
tctcaacaggccactggtctctccgagccccgtgtggatggagggagcagtaactccggt
agtaggaagtgctacaagttggataatgagaagctctttgaagagttccttgaactgtgt
aagacggagacatcagaccaccctgaggtggttccgttcctccacaaactgcagcagcgt
gcccagtctgtgtttctggcctctgcagagttctgcaacatcctctccagggttctggct
cggtctcggaagcggcccgctaagatctatgtgtacattaacgagctctgcactgttctt
aaagctcactccatcaagaagaagttgaacttagctcctgcagcctcaacgaccagtgag
gcgtcgggccctaaccctcccacagagcccccctctgaccttacaaacactgaaaacact
gcctctgaggcctcaaggactcgcggttcccggaggcagatccagcgcctggagcagctg
ctggcactgtacgtagccgagattcggcggctgcaggagaaggagttggacctgtcagag
ctggatgacccagactcctcgtatttgcaggaggcccgcttgaagaggaagttgatccgc
ctcttcgggcggttgtgtgagttgaaggactgctcttctctgacggggcgggtcatagag
cagcgaattccgtaccgaggcacccggtacccagaggtcaacaggcgcattgaacggctc
attaacaagccggggctggacaccttccccgattatggagatgtgctgagagccgtggag
aaggcggcgacccggcacagcctgggccttcccagacagcagcttcagctcctggctcag
gatgccttccgggacgtgggcgtcaggttacaggagcggcgccacctggatctcatctac
aactttggctgtcacctcacagatgactataggccaggcgttgaccccgcactgtctgat
cccacattggctcgccgccttcgggaaaatcgaaccttggccatgaaccggctggatgag
gtcatctccaagtatgcaatgatgcaagacaagactgaggagggcgagagacagaagaga
cgagcccggctcttaggcaccgccccccaaccttcagacccccccaaagcctcctcggaa
tctggtgagggtcctagcggaatggcatcccaggagtgccctactacctccaaagctgag
actgatgatgacgatgatgacgatgatgatgacgacgacgaagataacgaggaaagtgag
gaggaggaggaggaggaagaggaggagaaagaggctactgaagatgaagatgaggatcta
gaacagttgcaggaagatcaggggggtgatgaagaagaggaaggaggagataatgaagga
aatgagagtcccacatcgccttcagactttttccatagaaggaattcagagcctgcagaa
gggctcaggacccccgaggggcagcaaaagagaggactgacagagaccccagcatccccg
ccaggggcatccctggaccctcccagcactgacgctgagagcagtggagagcagctcctc
gagccgctcctgggagacgagagtcctgtgtcccagctcgctgagctagagatggaagct
ttgcctgaggaaagggacatttcctcctccaggaaaaagtcggaagattccctccccacc
atcttggaaaatggggcagctgtggttacctctacatctgtcaatgggcgtgtctcttct
cacacttggagagatgccagtccccccagcaagagatttcggaaggaaaagaagcaactg
ggctctggactgttaggaaacagctatataaaagaaccgatggcacagcaggacagtggg
cagaacacaagtgtccagcctatgccatccccccccttggcctctgtggcttctgtcgct
gattcctccacaagggtggactctcccagccatgaactggtgaccagctctctgtgcagc
ccttctccatccctgcttctccagacaccccaggctcagtctctccggcagtgtatttat
aagaccagtgtggccacacagtgcgacccggaggagatcatcgtgctttcagactctgat
tag

DBGET integrated database retrieval system