KEGG   Mus musculus (mouse): 13198
Entry
13198             CDS       T01002                                 

Gene name
Ddit3, AltDDIT3, CHOP-, CHOP-10, CHOP10, ch, chop, gadd15, gadd153
Definition
(RefSeq) DNA-damage inducible transcript 3
  KO
K04452  DNA damage-inducible transcript 3
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04010  MAPK signaling pathway
mmu04141  Protein processing in endoplasmic reticulum
mmu04210  Apoptosis
mmu04932  Non-alcoholic fatty liver disease
mmu05010  Alzheimer disease
mmu05012  Parkinson disease
mmu05014  Amyotrophic lateral sclerosis
mmu05020  Prion disease
mmu05022  Pathways of neurodegeneration - multiple diseases
mmu05202  Transcriptional misregulation in cancer
mmu05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    13198 (Ddit3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    13198 (Ddit3)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    13198 (Ddit3)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    13198 (Ddit3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    13198 (Ddit3)
   05012 Parkinson disease
    13198 (Ddit3)
   05014 Amyotrophic lateral sclerosis
    13198 (Ddit3)
   05020 Prion disease
    13198 (Ddit3)
   05022 Pathways of neurodegeneration - multiple diseases
    13198 (Ddit3)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    13198 (Ddit3)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    13198 (Ddit3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    13198 (Ddit3)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   C/EBP-like factors
    13198 (Ddit3)
SSDB
Motif
Pfam: GAS bZIP_2 bZIP_1 DivIC Gcd10p Fungal_TACC DASH_Hsk3 DASH_Spc19 WDCP RR_TM4-6 NAM-associated DUF5595 DUF5094 MAJIN DUF4407 Phlebovirus_NSM Neur_chan_memb
Other DBs
NCBI-GeneID: 13198
NCBI-ProteinID: NP_001277112
MGI: 109247
Ensembl: ENSMUSG00000025408
Vega: OTTMUSG00000032537
UniProt: P35639 Q3V405
Position
10; 10 D3
AA seq 168 aa
MAAESLPFTLETVSSWELEAWYEDLQEVLSSDEIGGTYISSPGNEEEESKTFTTLDPASL
AWLTEEPGPTEVTRTSQSPRSPDSSQSSMAQEEEEEEQGRTRKRKQSGQCPARPGKQRMK
EKEQENERKVAQLAEENERLKQEIERLTREVETTRRALIDRMVSLHQA
NT seq 507 nt   +upstreamnt  +downstreamnt
atggcagctgagtccctgcctttcaccttggagacggtgtccagctgggagctggaagcc
tggtatgaggatctgcaggaggtcctgtcctcagatgaaattgggggcacctatatctca
tccccaggaaacgaagaggaagaatcaaaaaccttcactactcttgaccctgcgtcccta
gcttggctgacagaggagccagggccaacagaggtcacacgcacatcccaaagccctcgc
tctccagattccagtcagagttctatggcccaggaggaagaggaggaagagcaaggaaga
actaggaaacggaaacagagtggtcagtgcccagcccggcctgggaagcaacgcatgaag
gagaaggagcaggagaacgagcggaaagtggcacagctagctgaagagaacgagcggctc
aagcaggaaatcgagcgcctgaccagggaggtggagaccacacggcgggctctgatcgac
cgcatggtcagcctgcaccaagcatga

DBGET integrated database retrieval system