KEGG   Mus musculus (house mouse): 13852
Entry
13852             CDS       T01002                                 
Symbol
Stx2, AW538950, Epim, G1-536-1, Syn-2, repro34
Name
(RefSeq) syntaxin 2
  KO
K08486  syntaxin 1B/2/3
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04130  SNARE interactions in vesicular transport
mmu04721  Synaptic vesicle cycle
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04130 SNARE interactions in vesicular transport
    13852 (Stx2)
 09150 Organismal Systems
  09156 Nervous system
   04721 Synaptic vesicle cycle
    13852 (Stx2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    13852 (Stx2)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    13852 (Stx2)
Membrane trafficking [BR:mmu04131]
 SNARE
  Syntaxin (Qa)
   Stx-PM
    13852 (Stx2)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   13852 (Stx2)
  Exosomal proteins of other body fluids (saliva and urine)
   13852 (Stx2)
SSDB
Motif
Pfam: Syntaxin SNARE Syntaxin_2 DUF3671 Lge1 DUF6161 Syntaxin-6_N CbiA COG5 Orf78 DUF16 Tlp Med28 ApoLp-III RNF152_C DUF2205 DUF6584 DUF2207
Other DBs
NCBI-GeneID: 13852
NCBI-ProteinID: NP_001272962
MGI: 108059
Ensembl: ENSMUSG00000029428
Vega: OTTMUSG00000027708
UniProt: Q80W45 Q3TJ55
Position
5:complement(129061621..129085664)
AA seq 288 aa
MRDRLPDLTACRTNDDGDTAVVIVEKDHFMDGFFHQVEEIRSSIARIAQHVEDVKKNHSI
ILSAPNPEGKIKEELEDLNKEIKKTANRIRGKLKSIEQSCDQDENGNRTSVDLRIRRTQH
SVLSRKFVDVMTEYNEAQILFRERSKGRIQRQLEITGRTTTDDELEEMLESGKPSIFISD
IISDSQITRQALNEIESRHKDIMKLETSIRELHEMFMDMAMFVETQGEMVNNIERNVVNS
VDYVEHAKEETKKAIKYQSKARRKVMFVLICVVTLLVILGIILATALS
NT seq 867 nt   +upstreamnt  +downstreamnt
atgcgggaccggctgcccgacctcacggcgtgtaggacaaacgacgatggagacactgct
gtcgtcattgtggagaaggatcatttcatggacggtttcttccatcaggtagaggagatt
cgaagcagcatagccaggattgctcagcatgtagaagacgtgaagaagaaccacagcatc
atcctgtctgctccaaacccagaaggaaaaataaaagaagagctggaggacctgaacaaa
gagatcaagaaaactgctaacaggatccggggcaagctgaagtctattgagcagagctgt
gatcaggacgagaatgggaaccgaacttcagtggatctgcggatacgaaggacccagcac
tcggtgctgtcacggaagtttgtggacgtcatgacagaatacaatgaagcgcagatcctg
ttccgggagcgaagcaaaggccgcatccagcgccagctggagatcactgggaggaccacc
actgacgacgagctggaagagatgctggagagcgggaagccgtccatcttcatctcggat
attatatcagattcacaaatcactaggcaagctctcaatgagatcgagtcccgccacaaa
gacatcatgaagctggagaccagcatccgagagctgcacgagatgttcatggatatggcc
atgtttgtcgagactcagggtgaaatggtcaacaacatcgagagaaatgtggtgaactct
gtagattacgtggaacatgccaaggaagagacgaagaaagccatcaaataccagagcaag
gccaggcggaaggtgatgttcgtcctcatttgtgtagtcactttgcttgtgatccttgga
attattctcgcaacagcattgtcatag

KEGG   Mus musculus (house mouse): 20907
Entry
20907             CDS       T01002                                 
Symbol
Stx1a, HPC-1
Name
(RefSeq) syntaxin 1A (brain)
  KO
K04560  syntaxin 1A
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04130  SNARE interactions in vesicular transport
mmu04721  Synaptic vesicle cycle
mmu04911  Insulin secretion
mmu05016  Huntington disease
mmu05022  Pathways of neurodegeneration - multiple diseases
mmu05031  Amphetamine addiction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04130 SNARE interactions in vesicular transport
    20907 (Stx1a)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    20907 (Stx1a)
  09156 Nervous system
   04721 Synaptic vesicle cycle
    20907 (Stx1a)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05016 Huntington disease
    20907 (Stx1a)
   05022 Pathways of neurodegeneration - multiple diseases
    20907 (Stx1a)
  09165 Substance dependence
   05031 Amphetamine addiction
    20907 (Stx1a)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    20907 (Stx1a)
Membrane trafficking [BR:mmu04131]
 SNARE
  Syntaxin (Qa)
   Stx-PM
    20907 (Stx1a)
SSDB
Motif
Pfam: Syntaxin SNARE Syntaxin_2 AAA_13 Ferritin GNVR Prominin PspA_IM30 DUF6664 Laminin_II FAD_binding_1 FlgN Lzipper-MIP1 Syntaxin-6_N SIMPL FapA ANIS5_cation-bd Lipoprotein_2 DUF1910
Other DBs
NCBI-GeneID: 20907
NCBI-ProteinID: NP_058081
MGI: 109355
Ensembl: ENSMUSG00000007207
Vega: OTTMUSG00000016270
UniProt: O35526 Q497P1 Q5D0A4
Position
5:135051473..135079954
AA seq 288 aa
MKDRTQELRTAKDSDDDDDVTVTVDRDRFMDEFFEQVEEIRGFIDKIAENVEEVKRKHSA
ILASPNPDEKTKEELEELMSDIKKTANKVRSKLKSIEQSIEQEEGLNRSSADLRIRKTQH
STLSRKFVEVMSEYNATQSDYRERCKGRIQRQLEITGRTTTSEELEDMLESGNPAIFASG
IIMDSSISKQALSEIETRHSEIIKLETSIRELHDMFMDMAMLVESQGEMIDRIEYNVEHA
VDYVERAVSDTKKAVKYQSKARRKKIMIIICCVILGIIIASTIGGIFG
NT seq 867 nt   +upstreamnt  +downstreamnt
atgaaggaccgaacccaggagctccgcacggccaaggacagcgatgacgacgacgatgtc
actgtcactgtggaccgagaccgcttcatggatgaattctttgaacaggtggaagagatc
cggggctttattgacaagattgccgaaaacgtggaggaggtgaagcggaaacacagcgcc
atcctggcctccccgaaccccgatgagaagacaaaggaggaactggaggagctcatgtcg
gacattaagaagacagcgaacaaagttcgctccaagctaaagagcattgagcagagcatc
gagcaggaggaaggtctgaaccgctcatcagccgacctgaggatccggaagacgcagcac
tccacgctgtcccgaaagtttgtggaggtcatgtccgagtacaacgccactcagtcagac
taccgagaacgctgcaaagggcgcatccagaggcagctggagatcaccggccggaccacg
accagtgaggaattggaagacatgctggagagtgggaaccctgccatctttgcctctggg
atcatcatggactccagcatctcgaagcaggccctcagtgagatcgagaccagacacagt
gagatcatcaagctggagaccagcatccgggagctgcacgacatgttcatggacatggcc
atgctggtggagagccagggggagatgattgacaggatcgagtacaatgtggagcacgcc
gtggactacgtggagagggccgtgtcagacaccaagaaggccgtcaagtaccagagcaag
gcgcgcaggaagaagatcatgatcatcatttgctgtgtgattctgggcatcatcatcgcc
tccaccatcgggggcatctttggatag

KEGG   Mus musculus (house mouse): 20908
Entry
20908             CDS       T01002                                 
Symbol
Stx3, Syn-3
Name
(RefSeq) syntaxin 3
  KO
K08486  syntaxin 1B/2/3
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04130  SNARE interactions in vesicular transport
mmu04721  Synaptic vesicle cycle
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04130 SNARE interactions in vesicular transport
    20908 (Stx3)
 09150 Organismal Systems
  09156 Nervous system
   04721 Synaptic vesicle cycle
    20908 (Stx3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    20908 (Stx3)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    20908 (Stx3)
Membrane trafficking [BR:mmu04131]
 SNARE
  Syntaxin (Qa)
   Stx-PM
    20908 (Stx3)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   20908 (Stx3)
  Exosomal proteins of other body fluids (saliva and urine)
   20908 (Stx3)
SSDB
Motif
Pfam: Syntaxin SNARE Syntaxin_2 Branch GyrB_insert DUF3040 DUF5984 LPD11 SIMPL Podoplanin T2SSF
Other DBs
NCBI-GeneID: 20908
NCBI-ProteinID: NP_689344
MGI: 103077
Ensembl: ENSMUSG00000041488
Vega: OTTMUSG00000061360
UniProt: Q64704 Q3UZI9
Position
19:complement(11752482..11798933)
AA seq 289 aa
MKDRLEQLKAKQLTQDDDTDEVEIAIDNTAFMDEFFSEIEETRLNIDKISEHVEEAKKLY
SIILSAPIPEPKTKDDLEQLTTEIKKRANNVRNKLKSMEKHIEEDEVRSSADLRIRKSQH
SVLSRKFVEVMTKYNEAQVDFRERSKGRIQRQLEITGKKTTDEELEEMLESGNPAIFTSG
IIDSQISKQALSEIEGRHKDIVRLESSIKELHDMFMDIAMLVENQGEMLDNIELNVMHTV
DHVEKARDETKRAMKYQGQARKKLIIIIVVVVVLLGILALIIGLSVGLK
NT seq 870 nt   +upstreamnt  +downstreamnt
atgaaggaccggctggagcagctgaaggccaagcagctgacgcaggatgatgacacggac
gaggttgagattgccattgacaacacagccttcatggacgagttcttctctgagatcgag
gaaacacggctcaacattgacaagatctcggagcatgtagaggaagctaagaaactctac
agtatcattctctctgcaccgatcccagagccaaaaaccaaagatgaccttgaacagctc
acaactgagatcaagaaaagggccaacaacgtccggaacaagctgaagagcatggagaag
cacattgaggaagatgaggttcggtcatctgcagaccttcggatacgaaagtcccagcac
tccgtcctctcccggaagtttgtggaggtgatgacaaagtacaatgaggctcaggtggac
ttccgtgaacgcagcaaagggcgcatccaacggcagcttgaaattactggcaagaagaca
acagatgaggagctggaagagatgttggagagtggcaacccagccatcttcacttctggg
atcattgactcccagatttccaagcaagccctcagcgagattgagggtcggcacaaggac
atcgtaaggctggagagcagcatcaaggagctccatgacatgtttatggacatcgccatg
ctggtggaaaatcagggggagatgttagataacatagagttgaatgtcatgcacacagtg
gaccatgtggagaaggcacgggatgaaactaaaagagccatgaagtatcagggtcaggct
cggaagaaattgataattatcattgtggtagtagttgtgttgctgggcattttagcgttg
attattggactgtccgttgggctgaaataa

KEGG   Mus musculus (house mouse): 56216
Entry
56216             CDS       T01002                                 
Symbol
Stx1b, Stx1b2, Stx1bl, Syn1b
Name
(RefSeq) syntaxin 1B
  KO
K08486  syntaxin 1B/2/3
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04130  SNARE interactions in vesicular transport
mmu04721  Synaptic vesicle cycle
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04130 SNARE interactions in vesicular transport
    56216 (Stx1b)
 09150 Organismal Systems
  09156 Nervous system
   04721 Synaptic vesicle cycle
    56216 (Stx1b)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    56216 (Stx1b)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    56216 (Stx1b)
Membrane trafficking [BR:mmu04131]
 SNARE
  Syntaxin (Qa)
   Stx-PM
    56216 (Stx1b)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   56216 (Stx1b)
  Exosomal proteins of other body fluids (saliva and urine)
   56216 (Stx1b)
SSDB
Motif
Pfam: Syntaxin SNARE Syntaxin_2 AAA_13 Lzipper-MIP1 GNVR FAD_binding_1 Baculo_PEP_C Acyl-CoA_dh_2 TolA_bind_tri Uso1_p115_C Jnk-SapK_ap_N
Other DBs
NCBI-GeneID: 56216
NCBI-ProteinID: NP_077725
MGI: 1930705
Ensembl: ENSMUSG00000030806
Vega: OTTMUSG00000031121
UniProt: P61264
Position
7:complement(127403072..127423703)
AA seq 288 aa
MKDRTQELRSAKDSDDEEEVVHVDRDHFMDEFFEQVEEIRGCIEKLSEDVEQVKKQHSAI
LAAPNPDEKTKQELEDLTADIKKTANKVRSKLKAIEQSIEQEEGLNRSSADLRIRKTQHS
TLSRKFVEVMTEYNATQSKYRDRCKDRIQRQLEITGRTTTNEELEDMLESGKLAIFTDDI
KMDSQMTKQALNEIETRHNEIIKLETSIRELHDMFVDMAMLVESQGEMIDRIEYNVEHSV
DYVERAVSDTKKAVKYQSKARRKKIMIIICCVVLGVVLASSIGGTLGL
NT seq 867 nt   +upstreamnt  +downstreamnt
atgaaggatcggactcaggagctgcggagtgcgaaagacagtgatgatgaagaggaggtg
gtccacgtggatcgagaccactttatggatgagttcttcgagcaggtggaagagatccga
ggctgcatcgagaaactgtctgaggatgtggagcaagtgaagaaacagcacagcgccatt
cttgccgcccccaaccccgatgagaagactaaacaggagttggaggacctcacggcagac
atcaaaaagacggcaaacaaggtccggtccaagttgaaagcgatcgagcaaagcattgag
caggaagaggggctgaatcgttcctctgcggacctgcgcatccgtaagacccagcactcc
acactctcacggaagttcgtggaggtaatgaccgaatataatgcaactcagtccaagtac
cgggaccgctgcaaggaccgaatccagaggcagctggagatcactggcaggactactacc
aatgaagaactagaagacatgttggaaagcgggaagctggccatcttcactgatgatatc
aaaatggactcgcagatgacaaagcaagctctgaatgagatcgagacaaggcacaatgag
atcatcaaactggaaaccagcattcgagagctgcacgacatgtttgtggacatggccatg
ctcgtagagagccagggtgagatgatcgaccgaattgagtacaacgtggaacattccgtg
gactacgtggaacgagccgtgtctgacaccaagaaagctgtgaagtatcagagcaaggcc
aggaggaagaaaattatgatcatcatttgctgtgtggtgctgggggtggtcttggcgtca
tccattggggggacactgggcttgtag

DBGET integrated database retrieval system