KEGG   Mus musculus (mouse): 13870
Entry
13870             CDS       T01002                                 

Gene name
Ercc1, Ercc-, Ercc-1
Definition
(RefSeq) excision repair cross-complementing rodent repair deficiency, complementation group 1
  KO
K10849  DNA excision repair protein ERCC-1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu01524  Platinum drug resistance
mmu03420  Nucleotide excision repair
mmu03460  Fanconi anemia pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03420 Nucleotide excision repair
    13870 (Ercc1)
   03460 Fanconi anemia pathway
    13870 (Ercc1)
 09160 Human Diseases
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    13870 (Ercc1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:mmu03400]
    13870 (Ercc1)
DNA repair and recombination proteins [BR:mmu03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    Other NER factors
     13870 (Ercc1)
SSDB
Motif
Pfam: Rad10 HHH HHH_5 HHH_2
Other DBs
NCBI-GeneID: 13870
NCBI-ProteinID: NP_031974
MGI: 95412
Ensembl: ENSMUSG00000003549
Vega: OTTMUSG00000030622
UniProt: P07903
Position
7 A3; 7 9.6 cM
AA seq 298 aa
MDPGKDEESRPQPSGPPTRRKFVIPLEEEEVPCAGVKPLFRSSRNPTIPATSAHVAPQTY
AEYAITQPPGGAGATVPTGSEPAAGENPSQTLKTGAKSNSIIVSPRQRGNPVLKFVRNVP
WEFGEVIPDYVLGQSTCALFLSLRYHNLHPDYIHERLQSLGKNFALRVLLVQVDVKDPQQ
ALKELAKMCILADCTLVLAWSAEEAGRYLETYKAYEQKPADLLMEKLEQNFLSRATECLT
TVKSVNKTDSQTLLATFGSLEQLFTASREDLALCPGLGPQKARRLFEVLHEPFLKVPR
NT seq 897 nt   +upstreamnt  +downstreamnt
atggaccctgggaaggacgaggaaagtcggccacagccctcaggaccacccaccaggagg
aagtttgttatcccactggaggaagaagaggtgccctgtgcaggggtcaagcccttattc
agatcgtcacggaatcccaccatcccagcaacctcagcccacgtggcccctcagacgtat
gctgagtacgccatcacccagcctccaggaggggctggggccacagtgcccacaggctct
gaacctgcggcaggagagaaccccagccagaccctgaaaacaggagcaaagtctaatagc
atcatcgtgagcccgaggcagaggggcaaccccgtgttgaagtttgtgcgcaatgtgccc
tgggaattcggtgaggtgattcccgattatgtgctgggccagagcacctgcgcccttttc
ctcagcctccgctaccacaacctccatccagactacatccatgaacggctgcagagcctg
gggaagaacttcgcccttcgtgtgctgctggttcaagtggatgtgaaagatccccagcag
gctctcaaggagctggctaagatgtgcatcttggctgactgcaccctggtcctggcctgg
agtgcagaggaagcagggcggtacctggagacctacaaggcgtatgagcagaagccagcc
gacctccttatggaaaagctggagcagaacttcctatcacgggccactgagtgtctgacc
accgtgaaatctgtgaacaagaccgacagccagaccctcctggctacatttggatccctg
gaacagctcttcaccgcatcaagggaggatctagccttatgcccgggcctgggcccacag
aaggcccgcaggctctttgaagtactacacgaacccttcctcaaagtgcctcgatga

DBGET integrated database retrieval system