KEGG   Mus musculus (mouse): 13871
Entry
13871             CDS       T01002                                 

Gene name
Ercc2, AA407812, AU020867, AW240756, CXPD, Ercc-, Ercc-2, Mhdarc, Mhdarco15, RCO0, RCO015, XP, XPD
Definition
(RefSeq) excision repair cross-complementing rodent repair deficiency, complementation group 2
  KO
K10844  DNA excision repair protein ERCC-2 [EC:3.6.4.12]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03022  Basal transcription factors
mmu03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09121 Transcription
   03022 Basal transcription factors
    13871 (Ercc2)
  09124 Replication and repair
   03420 Nucleotide excision repair
    13871 (Ercc2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:mmu03021]
    13871 (Ercc2)
   03400 DNA repair and recombination proteins [BR:mmu03400]
    13871 (Ercc2)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     13871 (Ercc2)
Transcription machinery [BR:mmu03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     13871 (Ercc2)
DNA repair and recombination proteins [BR:mmu03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TFIIH complex
     13871 (Ercc2)
SSDB
Motif
Pfam: DEAD_2 Helicase_C_2 HBB ResIII SNF2-rel_dom SesA
Other DBs
NCBI-GeneID: 13871
NCBI-ProteinID: NP_031975
MGI: 95413
Ensembl: ENSMUSG00000030400
Vega: OTTMUSG00000023168
UniProt: O08811
Position
7 A3; 7 9.62 cM
AA seq 760 aa
MKLNVDGLLVYFPYDYIYPEQFSYMLELKRTLDAKGHGVLEMPSGTGKTVSLLALIVAYQ
RAYPLEVTKLIYCSRTVPEIEKVIEELRKLLSFYEQQEGEKLPFLGLALSSRKNLCIHPE
VTPLRFGKDVDGKCHSLTASYVRAQYQQDASLPHCRFYEEFDIHGRQMPLPAGIYNLDDL
KALGQRQGWCPYFLARYSILHANVVVYSYHYLLDPKIADLVSKELARKAVVVFDEAHNID
NVCIDSMSVNLTRRTLDRCQSNLDTLQKTVLRIKETDEQRLRDEYRRLVEGLREASVARE
TDAHLANPVLPDEVLQEAVPGSIRTAEHFLGFLRRLLEYVKWRLRVQHVVQESPPAFLSG
LAQRVCIQRKPLRFCAERLRSLLHTLEIADLADFSPLTLLANFATLVSTYAKGFTIIIEP
FDDRTPTIANPVLHFSCMDASLAIKPVFERFQSVIITSGTLSPLDIYPKILDFHPVTMAT
FTMTLARVCLCPMIIGRGNDQVAISSKFETREDIAVIRNYGNLLLEMSAVVPDGIVAFFT
SYQYMESTVASWYEQGILENIQRNKLLFIETQDGAETSVALEKYQEACENGRGAILLSVA
RGKVSEGIDFVHHYGRAVIMFGVPYVYTQSRILKARLEYLRDQFQIRENDFLTFDAMRHA
AQCVGRAIRGKTDYGLMVFADKRFARADKRGKLPRWIQEHLTDSNLNLTVDEGVQVAKYF
LRQMAQPFHREDQLGLSLLSLEQLQSEETLQRIEQIAQQL
NT seq 2283 nt   +upstreamnt  +downstreamnt
atgaagctcaacgtggacgggctgctggtctacttcccgtacgactacatctacccggag
cagttctcctacatgctggagctcaagcgcacgctggacgccaagggtcatggagtcctg
gagatgccctcgggcactgggaagacagtgtccctattggccctgattgtggcctatcag
cgggcttatccgctggaggtgaccaaacttatctactgctcacggaccgtgccagagatt
gagaaggtcatagaagagcttcgtaagctactcagcttctacgagcagcaggagggcgag
aagctgccgttcttaggactggctctgagctcaagaaagaacctgtgcattcatcccgag
gtgactccactgcgctttgggaaggatgttgatgggaagtgtcacagcctaacggcgtcg
tatgtgcgggcacagtaccagcaggatgccagcctgcctcactgccgcttctatgaggaa
tttgacatccatggacgccagatgccgctccctgcgggcatctacaacctggatgacctg
aaggccctagggcagcgccagggctggtgcccctacttcctggctcgatactcgatcctg
catgccaacgtggtggtttacagctaccactacctcctggaccccaagatcgcagacctg
gtatccaaagagctggctcgcaaggctgttgtggtcttcgatgaagctcacaacatcgac
aatgtctgcattgactccatgagtgtcaacctcacccgcaggactctggaccgttgccag
agcaacttagacaccctacagaagaccgtgctcaggatcaaggagacggatgagcagcgg
ctgcgggatgagtaccggcgcctggtggagggcctgcgggaggccagtgtggcccgggag
acagatgcccacctggccaaccctgtgctgccggacgaggtgctgcaggaggctgtgcct
ggctccatccgtacggctgagcacttcctgggctttctgcggcggctgctggagtatgtc
aagtggcgtctgcgcgtgcagcatgtggtgcaggagagtccacctgcctttctgagcggc
ctggcccagcgggtgtgcatccagcgcaagcccctcaggttctgtgctgaacgcctgcgc
tccctgctgcacaccctggagattgccgacctggccgacttctccccgctcacactcctt
gctaacttcgccactctcgtcagcacttacgccaagggcttcaccattatcattgagccc
tttgacgacaggacccccaccatcgccaaccccgttctgcacttcagctgtatggacgcc
tccttggccatcaagcctgtgtttgagcgcttccagtctgtcatcatcacttctgggaca
ctgtccccactggacatctaccccaagatcctggacttccaccctgtcacaatggcaacc
ttcaccatgacgctggcccgagtctgcctctgcccgatgatcattggccgtggtaatgac
caggtagcaatcagctccaaatttgagaccagagaagatattgctgtgatccgaaactat
ggcaacctcctgctggagatgtccgccgtggtcccagatggcattgtggccttctttacc
agctaccagtacatggaaagcaccgtggcctcctggtatgagcagggcatccttgagaac
atccagaggaacaaactgctcttcattgagacccaggatggggctgagaccagtgtggcc
ctggagaagtaccaagaggcatgcgagaatggccgtggggccattctgctctcagtggct
cggggcaaagtatcagaagggattgactttgtacaccactacggacgggctgtgatcatg
tttggagttccctatgtctatacccagagccgaattctcaaggcccggctagagtatctg
cgggaccagttccagatccgagagaacgacttcctcacctttgatgctatgcgccatgca
gcccagtgtgtgggtcgtgccatcaggggcaagacggactatggactcatggtctttgct
gacaagcggtttgctcgggcggacaagcgtggtaagctgcctcgctggatccaggagcac
ctgaccgactccaacctcaacctgaccgtggatgagggtgtacaggtcgccaagtacttc
ctgcggcagatggcgcagcccttccaccgggaggatcagctgggcctgtcgctgctcagc
ctggagcagctgcagtcagaggagacactacagcgaattgagcagatcgcacagcagctc
tga

DBGET integrated database retrieval system