KEGG   Mus musculus (mouse): 13872
Entry
13872             CDS       T01002                                 

Gene name
Ercc3, BTF2_p89, Ercc-3, XP, XPB
Definition
(RefSeq) excision repair cross-complementing rodent repair deficiency, complementation group 3
  KO
K10843  DNA excision repair protein ERCC-3 [EC:3.6.4.12]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03022  Basal transcription factors
mmu03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09121 Transcription
   03022 Basal transcription factors
    13872 (Ercc3)
  09124 Replication and repair
   03420 Nucleotide excision repair
    13872 (Ercc3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:mmu03021]
    13872 (Ercc3)
   03400 DNA repair and recombination proteins [BR:mmu03400]
    13872 (Ercc3)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     13872 (Ercc3)
Transcription machinery [BR:mmu03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     13872 (Ercc3)
DNA repair and recombination proteins [BR:mmu03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TFIIH complex
     13872 (Ercc3)
SSDB
Motif
Pfam: ERCC3_RAD25_C Helicase_C_3 ResIII Helicase_C SNF2-rel_dom AAA_34
Other DBs
NCBI-GeneID: 13872
NCBI-ProteinID: NP_598419
MGI: 95414
Ensembl: ENSMUSG00000024382
Vega: OTTMUSG00000023961
UniProt: P49135
Position
18; 18 B1
AA seq 783 aa
MGKRDRVDRDKKKSKKRQYEEEEEDEDDIPGNESQEAVPSAAGKQVDESSTKVDEYGAKD
YRQQMPLKGDHTSRPLWVAPDGHIFLEAFSPVYKYAQDFLVAIAEPVCRPTHVHEYKLTA
YSLYAAVSVGLQTSDITEYLRKLSKTGVPDGIIQFIKLCTVSYGKVKLVLKHNRYFVESS
HPDVIQHLLQDPVIRECRLRNAEGEATELITETFTSKSAISKTAAEGSGGPSTSQGVDAQ
ATSDIPKDLFDFYEQMDKDEEEEEETQTVSFEVKQEMIEELQKRCICLEYPLLAEYDFRN
DTLNPDINIDLKPTAVLRPYQEKSLRKMFGNGRARSGVIVLPCGAGKSLVGVTAACTVRK
RCLVLGNSAVSVEQWKAQFKMWSTIDDSQICRFTSDAKDKPIGCSVAISTYSMLGHTTKR
SWEAERVMEWLKTQEWGLMILDEVHTIPARMFRRVLTIVQAHCKLGLTATLVREDDKIVD
LNFLIGPKLYEANWMELQNNGYIAKVQCAEVWCPMSPEFYREYVAIKTKKRILLYTMNPN
KFRACQFLIKFHERRNDKIIVFADNVFALKEYAIRLNKPYIYGPTSQGERMQILQNFKHN
PKINTIFISKVGDTSFDLPEANVLIQISSHGGSRRQEAQRLGRVLRAKKGMVAEEYNAFF
YSLVSQDTQEMAYSTKRQRFLVDQGYSFKVITKLAGMEEEELAFSTKEEQQQLLQKVLAA
TDLDAEEEVVAGEFGSRSGQASRRCGTMSSLSGADDTVYMEYHSSRSKASSKHVHPLFKR
FRK
NT seq 2352 nt   +upstreamnt  +downstreamnt
atgggcaaaagagatcgagtggaccgcgacaaaaagaaatccaagaagaggcagtatgaa
gaggaagaggaagacgaagacgacattcctgggaacgagtctcaggaggcggtgccctcc
gccgctgggaaacaggtggacgagtccagcaccaaagtggatgagtatggagcaaaggac
tacagacagcagatgccactaaagggtgaccatacctccaggcccctctgggtggctcct
gatggccacattttcttggaagccttctctccagtttacaaatatgcccaagacttcctg
gtggcaattgcagagccggtgtgccggcctactcatgtacatgaatacaagctaaccgcc
tactccctctatgcagcggtcagtgttgggctgcaaaccagtgacattactgagtacctc
agaaagctcagtaagactggagttcctgatggaattatccagtttattaagctgtgcact
gtcagctatgggaaggtcaagctggtcctcaagcacaacaggtactttgttgaaagttcc
caccctgatgttatccagcatcttcttcaagacccagtgatccgggaatgtcgcttgagg
aacgccgagggcgaggccaccgaactcatcacagagacttttacaagcaaatctgctatt
tctaagacggcggcggaaggcagtggcgggccttctacttcgcagggggtagatgcacag
gccacgtctgacatacccaaagacctgtttgatttttatgagcaaatggacaaggatgag
gaggaggaggaagagacacagacagtgtcctttgaagttaagcaggaaatgatcgaggag
ctgcagaagcgctgcatctgcttagagtacccgctgctggcagagtatgacttccggaat
gacactctcaatcctgacatcaacattgacctgaagcccacagccgtactcagaccctat
caggagaagagcctgcggaagatgtttgggaacggacgagcacgctcaggagtcattgtt
cttccctgtggtgctgggaagtccctggtcggcgtgactgccgcatgcactgtcagaaag
cgctgtctcgtcctgggcaactcggctgtgtctgtggagcagtggaaagcccagtttaag
atgtggtcaaccatcgatgacagccagatctgccgcttcacctcagatgccaaggacaag
cccatcggctgctccgttgccattagcacttactctatgctgggccacaccaccaaaagg
tcctgggaagctgagagagtcatggagtggctcaaaacccaggagtggggcctcatgatc
cttgacgaggtgcacaccattccagccaggatgttccggcgggttctgactattgtgcag
gcgcactgtaagcttggtttgactgcaacccttgtccgggaagatgacaaaattgttgac
ttaaatttcctgattgggcccaagctctatgaagccaactggatggagctgcagaacaat
gggtacatcgctaaagtccagtgtgctgaggtttggtgcccgatgtctcccgagttctac
cgagagtatgtggcaatcaaaacaaagaaacggatcctgttgtacaccatgaatcccaac
aaattcagagcctgccagtttctgatcaagtttcatgaaaggaggaatgacaagattatt
gtctttgctgacaacgtatttgccttgaaggaatatgccattcggctgaacaaaccttat
atctacgggcccacgtcccagggagaacgtatgcagattctccagaacttcaagcacaac
cccaaaatcaacaccatcttcatctccaaggttggtgacacatcctttgatctgccagaa
gccaatgtcctcattcagatctcttcccatggtggctcccgacggcaggaagcccagaga
ctgggacgggtactcagagccaagaaagggatggtcgcagaggaatacaatgcctttttc
tactccctggtatctcaggacacacaggaaatggcttattctaccaagcgacagagattc
ctagtggatcaaggttacagctttaaggtaatcacaaagctagctggcatggaggaagag
gagctggcgttctccaccaaagaggagcagcagcagctcctgcagaaggtgctggcagcc
accgacttggatgcagaggaggaagtggtggctggagagtttggctctagatctggccag
gcatcccgacgctgtggcaccatgagctccctgtcaggcgcagacgacaccgtgtacatg
gagtaccactcctcccgaagcaaggcctccagcaagcacgtgcacccgcttttcaaacgc
ttcaggaagtga

DBGET integrated database retrieval system