KEGG   Mus musculus (mouse): 140781
Entry
140781            CDS       T01002                                 

Symbol
Myh7, B-MHC, MYH-beta/slow, MyHC-I, Myhc-b, Myhcb, beta-MHC, betaMHC, myHC-beta, myHC-slow
Name
(RefSeq) myosin, heavy polypeptide 7, cardiac muscle, beta
  KO
K17751  myosin heavy chain 6/7
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04022  cGMP-PKG signaling pathway
mmu04260  Cardiac muscle contraction
mmu04261  Adrenergic signaling in cardiomyocytes
mmu04919  Thyroid hormone signaling pathway
mmu05410  Hypertrophic cardiomyopathy
mmu05414  Dilated cardiomyopathy
mmu05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04022 cGMP-PKG signaling pathway
    140781 (Myh7)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    140781 (Myh7)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    140781 (Myh7)
   04261 Adrenergic signaling in cardiomyocytes
    140781 (Myh7)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    140781 (Myh7)
   05414 Dilated cardiomyopathy
    140781 (Myh7)
   05416 Viral myocarditis
    140781 (Myh7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mmu04812]
    140781 (Myh7)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Myosins
     140781 (Myh7)
SSDB
Motif
Pfam: Myosin_head Myosin_tail_1 Myosin_N IQ AAA_22 Filament Crescentin
Other DBs
NCBI-GeneID: 140781
NCBI-ProteinID: NP_542766
MGI: 2155600
Ensembl: ENSMUSG00000053093
Vega: OTTMUSG00000016385
UniProt: Q91Z83 B2RXX9
Position
14 C3; 14 28.01 cM
AA seq 1935 aa
MADAEMAAFGAAAPFLRKSEKERLEAQTRPFDLKKDVFVPDDKEEFVKAKIVSREGGKVT
AETENGKTVTVKEDQVMQQNPPKFDKIEDMAMLTFLHEPAVLYNLKERYASWMIYTYSGL
FCVTVNPYKWLPVYNAEVVAAYRGKKRSEAPPHIFSISDNAYQYMLTDRENQSILITGES
GAGKTVNTKRVIQYFAVIAAIGDRSKKDQTPGKGTLEDQIIQANPALEAFGNAKTVRNDN
SSRFGKFIRIHFGATGKLASADIETYLLEKSRVIFQLKAERDYHIFYQILSNKKPELLDM
LLITNNPYDYAFISQGETTVASIDDSEELMATDSAFDVLGFTPEEKNSIYKLTGAIMHFG
NMKFKQKQREEQAEPDGTEEADKSAYLMGLNSADLLKGLCHPRVKVGNEYVTKGQNVQQV
SYAIGALAKSVYEKMFNWMVTRINATLETKQPRQYFIGVLDIAGFEIFDFNSFEQLCINF
TNEKLQQFFNHHMFVLEQEEYKKEGIEWTFIDFGMDLQACIDLIEKPMGIMSILEEECMF
PKATDMTFKAKLYDNHLGKSNNFQKPRNVKGKQEAHFSLVHYAGTVDYNILGWLQKNKDP
LNETVVGLYQKSSLKLLSNLFANYAGADAPADKGKGKAKKGSSFQTVSALHRENLNKLMT
NLRSTHPHFVRCIIPNETKSPGVMDNPLVMHQLRCNGVLEGIRICRKGFPNRILYGDFRQ
RYRILNPAAIPEGQFIDSRKGAEKLLGSLDIDHNQYKFGHTKVFFKAGLLGLLEEMRDER
LSRIITRIQAQSRGVLSRMEFKKLLERRDSLLIIQWNIRAFMGVKNWPWMKLYFKIKPLL
KSAETEKEMATMKEEFGRVKDALEKSEARRKELEEKMVSLLQEKNDLQLQVQAEQDNLAD
AEERCDQLIKNKIQLEAKVKEMTERLEDEEEMNAELTAKKRKLEDECSELKRDIDDLELT
LAKVEKEKHATENKVKNLTEEMAGLDEIIVKLTKEKKALQEAHQQALDDLQAEEDKVNTL
TKAKVKLEQQVDDLEGSLEQEKKVRMDLERAKRKLEGDLKLTQESIMDLENDKQQLDERL
KKKDFELNALNARIEDEQALGSQLQKKLKELQARIEELEEELEAERTARAKVEKLRSDLS
RELEEISERLEEAGGATSVQIEMNKKREAEFQKMRRDLEEATLQHEATAAALRKKHADSV
AELGEQIDNLQRVKQKLEKEKSEFKLELDDVTSNMEQIIKAKANLEKMCRTLEDQMNEHR
SKAEETQRSVNDLTSQRAKLQTENGELSRQLDEKEALISQLTRGKLTYTQQLEDLKRQLE
EEVKAKNALAHALQSARHDCDLLREQYEEETEAKAELQRVLSKANSEVAQWRTKYETDAI
QRTEELEEAKKKLAQRLQDAEEAVEAVNAKCSSLEKTKHRLQNEIEDLMVDVERSNAAAA
ALDKKQRNFDKILAEWKQKYEESQSELESSQKEARSLSTELFKLKNAYEESLEHLETFKR
ENKNLQEEISDLTEQLGSTGKSIHELEKIRKQLEAEKLELQSALEEAEASLEHEEGKILR
AQLEFNQIKAEIERKLAEKDEEMEQAKRNHLRMVDSLQTSLDAETRSRNEALRVKKKMEG
DLNEMEIQLSHANRMAAEAQKQVKSLQSLLKDTQIQLDDAVRANDDLKENIAIVERRNNL
LQAELEELRAVVEQTERSRKLAEQELIETSERVQLLHSQNTSLINQKKKMDADLSQLQTE
VEEAVQECRNAEEKAKKAITDAAMMAEELKKEQDTSAHLERMKKNMEQTIKDLQHRLDEA
EQIALKGGKKQLQKLEARVRELENELEAEQKRNAESVKGMRKSERRIKELTYQTEEDRKN
LLRLQDLVDKLQLKVKAYKRQAEEAEEQANTNLSKFRKVQHELDEAEERADIAESQVNKL
RAKSRDIGAKGLNEE
NT seq 5808 nt   +upstreamnt  +downstreamnt
atggcggatgcagagatggctgcatttggggctgcagcccccttcctgcggaagtctgag
aaggagaggctggaggcacagaccaggccctttgacctcaagaaagatgtttttgtgccc
gatgacaaagaagagtttgtcaaggccaagatcgtgtcccgagagggtggcaaagtcact
gctgagacggagaatggcaagacggtgactgtgaaggaggaccaggtgatgcagcagaac
ccacccaagttcgacaagatcgaggacatggccatgctgaccttcctgcatgagccggct
gtgctgtacaacctcaaggagcgctacgcttcctggatgatctatacctactcgggcctc
ttctgcgtcaccgtcaacccctacaagtggctgcctgtgtacaatgcggaagtggtggct
gcctaccggggcaagaagaggagcgaggcccctcctcacatcttctccatctctgacaac
gcctatcagtacatgctgacagatcgggagaatcagtccatcctcatcaccggagaatcc
ggagctgggaagactgtcaacactaagagggtcatccaatattttgctgttattgccgcc
attggggaccgcagcaagaaggaccagaccccaggcaagggtaccctggaagatcaaatc
atccaagccaaccctgctctggaggcctttggcaatgccaagacagttcggaatgacaac
tcctctcgatttgggaaattcatccgaatccattttggggcaacaggaaagttggcatct
gcagacatagagacctaccttctggaaaaatccagggttattttccagctgaaagcagaa
agagattatcacattttctaccaaatcctgtctaataaaaagcctgagcttctagacatg
ctgctgatcaccaacaacccctacgattatgcgttcatctcccaaggagagacgactgtg
gcctccattgatgactctgaagagctcatggccacggatagcgcctttgacgtgctgggc
ttcactccagaagagaagaactccatttacaagctgacaggcgccatcatgcactttgga
aacatgaagttcaagcagaagcagcgggaggagcaggcggaaccagacggcactgaagag
gctgacaaatcagcctacctcatggggctgaactcagccgacctgcttaaggggctgtgc
catcctagagtcaaagtgggcaacgagtacgtcaccaaggggcagaatgtccagcaggtg
tcatacgccatcggggcactggccaagtcagtgtacgagaagatgttcaactggatggtg
acacgcatcaatgcaaccctggagaccaagcagccgcgccagtacttcataggtgtcctg
gacattgccggctttgagatcttcgatttcaacagctttgagcagctgtgcatcaacttc
accaatgagaagctgcagcagttcttcaaccaccacatgttcgtgctggagcaggaggag
tacaagaaggagggcattgagtggaccttcatagacttcggcatggacttgcaggcctgc
attgacctcatcgagaagcccatgggcatcatgtccatccttgaggaggagtgcatgttc
cccaaggccacagacatgaccttcaaggccaagctgtacgacaaccacctgggcaagtcc
aacaacttccagaagcctcgaaatgtcaaggggaagcaggaagcccacttctctttggtc
cactatgctggcactgtggactacaatatcctgggctggctacagaagaacaaggaccca
ctcaatgagacggtggtgggtttgtaccagaagtcttccctcaagctgctcagcaatcta
tttgccaactatgctggagctgatgccccggcggacaaaggcaaaggcaaggcaaagaaa
ggctcatcctttcagaccgtgtctgctctgcacagagaaaatctgaacaaacttatgaca
aacttgcgctccacgcaccctcactttgtacgctgcatcatccccaatgagacaaagtct
ccaggggtgatggacaaccccctggtcatgcaccagctgcgatgcaatggcgtgctggag
ggtatccgcatctgcaggaagggcttccccaaccgcattctctatggggacttccggcag
aggtatcgcatcctgaacccagcagccatccctgaggggcaattcattgatagcaggaaa
ggggctgagaaactgctgggctccctggacattgaccacaaccaatacaagtttggtcac
accaaggtgttcttcaaggcgggcctgctggggctgctggaggagatgcgtgatgagagg
ctgagccgcatcatcaccagaatccaggcccagtcccgaggtgtgctctccagaatggag
ttcaagaagctgctggagcgcagagactccctgctgattatccagtggaacattagggcc
ttcatgggggtcaagaattggccgtggatgaagctctacttcaagatcaagccgctgctg
aagagcgcggagacggagaaggagatggccaccatgaaggaggagtttgggcgagtcaaa
gatgcactagagaagtctgaggctcgccgcaaggagctggaggagaagatggtgtccctg
ctgcaggagaagaatgacctgcagctccaagtgcaggcggaacaagacaacttggcggat
gcagaggagcgctgtgaccagctgatcaagaacaagatccagctggaggccaaggtgaag
gagatgaccgagaggctggaggacgaggaggagatgaatgccgagctcactgccaagaag
cgcaagctggaagatgagtgctcagagctcaagcgggatatcgatgacctggagctgacg
ctggccaaggtggagaaggaaaagcatgcaacagagaacaaggtgaaaaacctgacagag
gagatggctggtttggatgagatcattgtcaagctgacaaaggagaagaaagctctgcaa
gaggcccaccagcaggctctggatgacctgcaggctgaggaagacaaggtcaatactctg
accaaggccaaggtcaagctggagcagcaggtggatgatctggagggatccctggagcag
gagaagaaggtgcgcatggacctagagcgagccaagcggaagctggagggagacctgaag
ctgacgcaggagagcatcatggacctggagaatgacaagcagcagttggatgagcgactc
aaaaagaaggactttgagttaaatgcactcaatgccaggattgaggatgagcaagccctg
ggcagtcagctgcagaagaagctcaaggagcttcaggcacgcatcgaggagctggaggag
gagctggaggccgagcgcacagcccgggccaaggtggagaagctgcgctctgacctgtcc
cgggagctggaggagatcagtgaaaggctggaggaggcaggcggggccacatccgtgcag
atagagatgaacaagaagcgcgaggccgagttccagaagatgcggcgggacctggaggag
gccacgctgcagcacgaggccacggcggcggccctgcgcaagaagcatgccgacagcgtg
gcggagctgggcgagcagatcgacaacctccagcgggtgaagcagaagctggagaaagag
aaaagcgagttcaagctggagctggatgacgtcacctccaacatggagcagatcatcaag
gccaaggctaacctggagaagatgtgccggaccttggaagaccagatgaatgagcaccgg
agcaaggccgaggagacgcagcgttctgtcaatgacctcaccagccagcgggccaagctg
cagacagagaatggggagctgtcccggcagctggacgagaaggaggctctgatctctcag
ctaacccgaggcaagctcacatatacacagcagctggaggacctcaagaggcaactggag
gaggaggtcaaggccaagaacgcgctggcccacgcactgcagtcagcacggcatgattgt
gacctgctgagggaacagtatgaggaggagacagaggccaaggctgagctacagcgagtc
ctgtccaaggccaattcagaggtggcccagtggaggaccaagtatgagacggatgccata
cagaggacagaggagctggaggaagccaagaagaagctggctcagaggctgcaggatgca
gaggaggcagtggaggctgtcaatgccaagtgttcctctctggagaagaccaagcacagg
ctgcagaatgagatcgaggacctgatggtggacgtggagcgctccaatgccgccgccgca
gccctggacaagaagcagaggaactttgacaagatcctggctgagtggaagcagaagtat
gaggagtcgcagtcagagctggagtcttcccagaaggaggcgcgctccctgagcacagag
ctcttcaagctcaagaacgcctatgaggagtctctggagcacctagagaccttcaagcgg
gagaacaagaacctccaggaggagatctcagacctgactgagcagctgggctccacgggg
aagagcatccatgagctggagaagatccgaaagcaactggaggccgagaagctggagctg
cagtcggccctggaggaggctgaggcctccctggagcacgaggagggcaagatcctccgc
gcccagctagagttcaaccagatcaaggcagagattgaaaggaagctggcagagaaggat
gaggagatggagcaggccaagcgcaaccacctgcggatggtggactccctgcagacctcc
ctggatgcggagacacgcagccgcaatgaggccctgcgggtgaagaagaagatggagggc
gacctcaacgagatggagatccagctcagccatgccaaccgtatggctgctgaggcccag
aaacaagtgaagagcctccagagtctgctgaaggacactcaaatccagctggatgatgct
gtccgtgccaatgacgacctgaaagagaacatcgccatcgtggaacggcgcaacaacctg
ctgcaggcggagctggaggagcttcgggctgtggtggagcagacggagcggtctcggaag
ctggcagagcaggagctgattgagaccagcgagcgggtgcagctgctgcactcgcagaac
accagcctcatcaaccagaagaagaagatggatgcagacctatcccagctccagacagaa
gtagaggaggcagtgcaggagtgtaggaacgcagaggagaaggccaagaaggctatcaca
gatgccgccatgatggctgaggagctgaagaaggagcaggacaccagcgcccacctggag
cgcatgaagaagaacatggagcagaccatcaaggacttgcagcaccgtctggacgaggca
gagcagatcgccctcaagggcggcaagaagcagctgcagaagctggaggcccgggtccgg
gagctggagaatgagctggaggctgagcaaaagcgcaatgcagagtcagtgaagggcatg
aggaagagtgagcggcgcatcaaggagctcacctaccagacagaggaagacaggaagaac
ctactgcggctgcaggacctggtggacaagctgcagctgaaggtgaaggcctacaagcgc
caggctgaggaggcggaggagcaggccaacaccaacctgtccaagttccgcaaggtgcag
cacgagctggatgaggcggaggagagggcggacatcgccgagtcccaggtcaacaagctg
cgggccaagagccgggacattggtgccaagggcctgaatgaggagtag

KEGG   Mus musculus (mouse): 17888
Entry
17888             CDS       T01002                                 

Symbol
Myh6, A830009F23Rik, AA517445, Myhc-a, Myhca, alpha-MHC, alphaMHC
Name
(RefSeq) myosin, heavy polypeptide 6, cardiac muscle, alpha
  KO
K17751  myosin heavy chain 6/7
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04022  cGMP-PKG signaling pathway
mmu04260  Cardiac muscle contraction
mmu04261  Adrenergic signaling in cardiomyocytes
mmu04919  Thyroid hormone signaling pathway
mmu05410  Hypertrophic cardiomyopathy
mmu05414  Dilated cardiomyopathy
mmu05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04022 cGMP-PKG signaling pathway
    17888 (Myh6)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    17888 (Myh6)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    17888 (Myh6)
   04261 Adrenergic signaling in cardiomyocytes
    17888 (Myh6)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    17888 (Myh6)
   05414 Dilated cardiomyopathy
    17888 (Myh6)
   05416 Viral myocarditis
    17888 (Myh6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mmu04812]
    17888 (Myh6)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Myosins
     17888 (Myh6)
SSDB
Motif
Pfam: Myosin_head Myosin_tail_1 Myosin_N Filament Crescentin IQ AAA_22 AAA_16
Other DBs
NCBI-GeneID: 17888
NCBI-ProteinID: NP_001157643
MGI: 97255
Ensembl: ENSMUSG00000040752
Vega: OTTMUSG00000016384
UniProt: Q02566 B2RQQ1
Position
14 C3; 14 28.01 cM
AA seq 1938 aa
MTDAQMADFGAAAQYLRKSEKERLEAQTRPFDIRTECFVPDDKEEYVKAKVVSREGGKVT
AETENGKTVTIKEDQVMQQNPPKFDKIEDMAMLTFLHEPAVLYNLKERYAAWMIYTYSGL
FCVTVNPYKWLPVYNAEVVAAYRGKKRSEAPPHIFSISDNAYQYMLTDRENQSILITGES
GAGKTVNTKRVIQYFASIAAIGDRSKKENPNANKGTLEDQIIQANPALEAFGNAKTVRND
NSSRFGKFIRIHFGATGKLASADIETYLLEKSRVIFQLKAERNYHIFYQILSNKKPELLD
MLLVTNNPYDYAFVSQGEVSVASIDDSEELLATDSAFDVLSFTAEEKAGVYKLTGAIMHY
GNMKFKQKQREEQAEPDGTEDADKSAYLMGLNSADLLKGLCHPRVKVGNEYVTKGQSVQQ
VYYSIGALAKSVYEKMFNWMVTRINATLETKQPRQYFIGVLDIAGFEIFDFNSFEQLCIN
FTNEKLQQFFNHHMFVLEQEEYKKEGIEWEFIDFGMDLQACIDLIEKPMGIMSILEEECM
FPKASDMTFKAKLYDNHLGKSNNFQKPRNVKGKQEAHFSLVHYAGTVDYNIMGWLEKNKD
PLNETVVGLYQKSSLKLMATLFSTYASADTGDSGKGKGGKKKGSSFQTVSALHRENLNKL
MTNLKTTHPHFVRCIIPNERKAPGVMDNPLVMHQLRCNGVLEGIRICRKGFPNRILYGDF
RQRYRILNPAAIPEGQFIDSRKGAEKLLGSLDIDHNQYKFGHTKVFFKAGLLGLLEEMRD
ERLSRIITRIQAQARGQLMRIEFKKIVERRDALLVIQWNIRAFMGVKNWPWMKLYFKIKP
LLKSAETEKEMANMKEEFGRVKDALEKSEARRKELEEKMVSLLQEKNDLQLQVQAEQDNL
NDAEERCDQLIKNKIQLEAKVKEMTERLEDEEEMNAELTAKKRKLEDECSELKKDIDDLE
LTLAKVEKEKHATENKVKNLTEEMAGLDEIIAKLTKEKKALQEAHQQALDDLQAEEDKVN
TLTKSKVKLEQQVDDLEGSLEQEKKVRMDLERAKRKLEGDLKLTQESIMDLENDKLQLEE
KLKKKEFDISQQNSKIEDEQALALQLQKKLKENQARIEELEEELEAERTARAKVEKLRSD
LSRELEEISERLEEAGGATSVQIEMNKKREAEFQKMRRDLEEATLQHEATAAALRKKHAD
SVAELGEQIDNLQRVKQKLEKEKSEFKLELDDVTSNMEQIIKAKANLEKVSRTLEDQANE
YRVKLEEAQRSLNDFTTQRAKLQTENGELARQLEEKEALISQLTRGKLSYTQQMEDLKRQ
LEEEGKAKNALAHALQSSRHDCDLLREQYEEEMEAKAELQRVLSKANSEVAQWRTKYETD
AIQRTEELEEAKKKLAQRLQDAEEAVEAVNAKCSSLEKTKHRLQNEIEDLMVDVERSNAA
AAALDKKQRNFDKILAEWKQKYEESQSELESSQKEARSLSTELFKLKNAYEESLEHLETF
KRENKNLQEEISDLTEQLGEGGKNVHELEKIRKQLEVEKLELQSALEEAEASLEHEEGKI
LRAQLEFNQIKAEIERKLAEKDEEMEQAKRNHLRMVDSLQTSLDAETRSRNEALRVKKKM
EGDLNEMEIQLSQANRIASEAQKHLKNSQAHLKDTQLQLDDAVHANDDLKENIAIVERRN
NLLQAELEELRAVVEQTERSRKLAEQELIETSERVQLLHSQNTSLINQKKKMESDLTQLQ
TEVEEAVQECRNAEEKAKKAITDAAMMAEELKKEQDTSAHLERMKKNMEQTIKDLQHRLD
EAEQIALKGGKKQLQKLEARVRELENELEAEQKRNAESVKGMRKSERRIKELTYQTEEDK
KNLMRLQDLVDKLQLKVKAYKRQAEEAEEQANTNLSKFRKVQHELDEAEERADIAESQVN
KLRAKSRDIGAKKMHDEE
NT seq 5817 nt   +upstreamnt  +downstreamnt
atgacggacgcccagatggctgacttcggggcagcagcccagtacctccgaaagtcagag
aaggaacgcctagaggcccagacccggccctttgacatccgcacggagtgcttcgtgcct
gatgacaaggaggagtatgttaaggccaaggtcgtgtcccgggaagggggcaaagtcact
gcggaaactgaaaacggaaagacggtgaccataaaggaggaccaggtgatgcagcagaac
ccacccaagttcgacaagatcgaggacatggccatgctgaccttcctgcacgagccggct
gtgctgtacaacctcaaggagcgctacgcggcctggatgatctatacctactcaggcctc
ttctgcgtcaccgtcaacccctataagtggctgcctgtgtacaatgcggaagtggtggcc
gcctaccggggcaagaagaggagcgaggcccctcctcacatcttctccatctctgacaac
gcctatcagtacatgctgacagatcgggagaatcagtccatcctcatcaccggagaatcc
ggagcggggaagactgtgaacacaaaacgtgtcatccagtactttgccagcattgcagcc
ataggggaccgtagcaagaaggaaaatcctaatgcaaacaagggcaccctggaggaccag
attatccaggctaaccccgctctggaggccttcggcaacgccaagactgtccggaatgac
aactcctcccgctttgggaaattcatcaggatccactttggagctactggaaagctggct
tctgcagacatagagacctaccttctggagaagtcccgggtgatcttccagctaaaggct
gagaggaactaccacatcttctaccagatcctgtccaacaagaagccggagctgctggac
atgctgctggtcaccaacaacccatacgactacgccttcgtctctcagggagaggtgtcc
gtggcctccattgatgactctgaggagctcttggccactgatagtgcctttgatgtgctg
agcttcacggcagaggagaaggctggtgtctacaagctgacaggggccatcatgcactac
ggaaacatgaagttcaagcagaagcagcgggaggagcaggcggagcctgatggcacagaa
gatgctgacaaatctgcctaccttatggggctgaactcagctgacctgctcaagggcctg
tgtcaccctcgggtgaaggtggggaacgagtatgtcaccaaggggcagagtgtacagcaa
gtgtactattccatcggggcactggccaagtcagtgtacgagaagatgttcaactggatg
gtgacacgcatcaacgcaaccctggagaccaagcagccgcgccagtacttcataggtgtc
ctggacattgccggctttgagatcttcgatttcaacagctttgagcagctgtgcatcaac
ttcaccaatgagaagctgcagcagttcttcaaccaccacatgttcgtgctggagcaggag
gagtacaagaaggagggcattgagtgggagtttatcgacttcggcatggacctgcaggcc
tgcatcgacctcatcgagaagcccatgggcatcatgtccatcctcgaggaggagtgcatg
ttccccaaggcctcagacatgaccttcaaggccaagctgtatgacaaccacctgggcaaa
tccaacaacttccagaagcctcgcaatgtcaaggggaagcaggaagcccacttctccttg
gtccactatgctggcaccgtggactacaacattatgggctggctggaaaagaacaaggac
ccactcaatgagacggtggtgggtttgtaccagaagtcctccctcaagctcatggctaca
ctcttctctacctatgcttctgctgataccggtgacagtggtaaaggcaaaggaggcaag
aagaaaggctcatccttccaaacagtgtctgctctccaccgggaaaatctgaacaagctg
atgacaaacctgaagaccacccaccctcactttgtgcgctgcatcattcccaacgagcga
aaggctccaggggtgatggacaaccccctggtcatgcaccagctgcgatgcaatggcgtg
ctggagggtatccgcatctgcaggaagggcttccccaaccgcattctctatggggacttc
cggcagaggtatcgcatcctgaacccagcagccatccctgaggggcaattcattgatagc
aggaaaggggctgagaaactgctgggctccctggacattgaccacaaccaatacaagttt
ggccacaccaaggtgttcttcaaggcgggcctgctggggctgctcgaggagatgcgagat
gagaggctgagccgtatcatcaccagaatccaggcccaggcccgagggcagctcatgcgc
attgagttcaagaagatagtggaacgcagggatgccctgctggttatccagtggaacatt
cgggccttcatgggggtcaagaattggccatggatgaagctctacttcaagatcaaaccg
ctgctgaagagcgcagagacggagaaggagatggccaacatgaaggaggagtttgggcga
gtcaaagatgcactggagaagtctgaggctcgccgcaaggagctggaggagaagatggtg
tccctgctgcaggagaagaatgacctacagctccaagtgcaggcggaacaagacaacctc
aatgatgcagaggagcgctgtgaccagctgatcaagaacaagatccagctggaggccaag
gtgaaggagatgaccgagaggctggaggacgaggaggagatgaacgccgagctcactgcc
aagaagcgcaagctggaagatgagtgctcagagctcaagaaggatattgatgacctggag
ctgacgctggccaaggtggaaaaggaaaagcatgcaacagagaacaaggttaaaaaccta
acagaggagatggctgggctggatgaaatcattgccaagctgaccaaagagaagaaagct
ctgcaagaagcccaccagcaagccctcgatgacctgcaggctgaagaagacaaggtcaac
acgctgaccaagtccaaagtcaagctggagcagcaggtggatgatctggagggatccctg
gagcaggagaagaaagtgcgcatggacctagagcgagccaagcggaagctggagggagac
ctgaagctgacccaggagagcatcatggacctggagaatgacaagcttcagctggaagaa
aagctcaagaagaaagagttcgacatcagtcagcagaacagtaaaattgaggacgagcag
gccctggctcttcagctgcagaagaaactgaaggaaaaccaggcacgcatcgaggagctg
gaggaggagctggaggcagagcgcacagcccgggctaaggtggagaagctgcgctctgac
ctgtcccgggagctggaggagatcagtgagaggctggaggaggcaggcggggccacatcc
gtgcagatagagatgaataagaagcgcgaggccgagttccagaagatgcggcgggacctg
gaggaggccacgctgcagcacgaggccacggcggcggccctgcgcaagaagcatgctgac
agcgtggcggagctgggcgagcagatcgacaacctccagcgggtgaagcagaagctggag
aaagagaagagcgagttcaagctggagctggatgacgtcacctccaacatggagcagatc
atcaaggccaaggccaacctggagaaagtgtcccggacactggaggaccaggccaatgag
taccgcgtgaagctggaagaagcccagcgctccctcaatgacttcaccacacagcgagcc
aagctgcagacagagaacggggagttggctaggcaactggaagaaaaggaggcattgatt
tcccagctgacccgaggcaagctctcctacacccagcagatggaggacctcaagaggcaa
ctggaggaggaaggcaaggccaagaacgccctggcccacgcactgcaatcatcccggcat
gactgtgacctgctgagggaacagtatgaagaagaaatggaggccaaggctgagctacag
cgtgtcctgtccaaggccaactcagaggtggcccagtggaggaccaagtatgagacggat
gccatacagaggacggaggagctggaggaagccaagaagaagctggctcagaggctgcag
gatgcagaggaggcagtggaggccgtcaacgccaagtgttcctccctggagaagaccaag
cacaggctgcagaatgagatcgaggacctgatggtggacgtggagcgctccaatgccgcc
gccgcagccctggacaagaagcagaggaactttgacaagatcctggctgagtggaagcag
aagtatgaggagtcgcagtcagagctggagtcttcccagaaggaggcgcgctccctgagc
acagagctcttcaagctcaagaacgcctatgaggagtctctggagcacctggagaccttc
aagcgggagaacaagaacctccaggaggagatctcagacctgactgaacagctgggagaa
ggggggaaaaacgtgcacgagctggagaagatccgcaaacagctggaggtggagaagctg
gagctgcagtcagccctggaggaggctgaggcctccctggagcacgaggagggcaagatc
ctccgtgcccagctggagttcaaccagatcaaggcagagatcgaaaggaagctggcagag
aaggatgaggagatggagcaggccaagcgcaaccacctgcggatggtggactccctgcag
acctccctggatgcggagacacgcagccgcaatgaggccctgcgggtgaagaagaagatg
gagggcgacctcaacgagatggagatccagctcagccaggccaatagaatagcctcagag
gcacagaaacacctgaagaattctcaagctcacttgaaggacacccagctccagctggat
gatgctgtccatgccaatgacgacctgaaggagaacatcgccatcgtggaacggcgcaac
aacctgctgcaggcggagctggaggagctgcgggctgtggtggagcagacggagcggtct
cggaagctggcagagcaggagctgattgagaccagcgagcgggtgcagctgctgcactcg
cagaacaccagcctcatcaaccagaagaagaagatggagtcagacctgacccaactccag
acagaagtagaggaggcagtgcaggagtgtaggaacgcagaggagaaggccaagaaggcc
atcacagatgccgcaatgatggctgaggagctgaagaaggagcaggacaccagcgcccac
ctggagcgcatgaagaagaacatggagcagaccatcaaggacttgcagcaccgtctggac
gaggcagagcagatcgccctcaagggcggcaagaagcagctgcagaagctggaggcccgg
gtccgggagctggagaatgagctggaggctgagcagaagcgcaatgcagagtcggtgaag
ggcatgaggaagagcgagcggcgcatcaaggagctcacctaccagacagaggaagacaag
aagaacttaatgcggctgcaggacctggtggacaagctacagttgaaggtgaaggcctac
aagcgccaggctgaggaggcggaggagcaggccaacaccaacctgtccaagttccgcaag
gtgcagcacgagctggatgaggcggaggagagggcggacatcgccgagtcccaggtcaac
aagctgcgggccaagagccgggacattggtgccaagaagatgcacgacgaggaataa

KEGG   Mus musculus (mouse): 17896
Entry
17896             CDS       T01002                                 

Symbol
Myl4, ALC1, AMLC, ELC, ELC1a, GT1, MLC1EMB, MLC1a, Myla
Name
(RefSeq) myosin, light polypeptide 4
  KO
K12750  myosin light chain 4
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04260  Cardiac muscle contraction
mmu04261  Adrenergic signaling in cardiomyocytes
mmu04371  Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    17896 (Myl4)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    17896 (Myl4)
   04261 Adrenergic signaling in cardiomyocytes
    17896 (Myl4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mmu04812]
    17896 (Myl4)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Myosins
     17896 (Myl4)
SSDB
Motif
Pfam: EF-hand_1 EF-hand_9 EF-hand_6 EF-hand_7
Other DBs
NCBI-GeneID: 17896
NCBI-ProteinID: NP_001342683
MGI: 97267
Ensembl: ENSMUSG00000061086
Vega: OTTMUSG00000003179
Position
11 E1; 11 67.79 cM
AA seq 193 aa
MPPKKPEPKKETAKPAAAPAPAASAAPEPLKDSAFDPKSVKIDFSADQIEEFKEAFSLFD
RTPTGEMKITYGQCGDVLRALGQNPTNAEVLRVLGKPKPEEMSSKTLDFEMFLPILQHIS
RNKEQGTYEDFVEGLRVFDKESNGTVMGAELRHVLATLGEKMSEAEVEQLLSGQEDANGC
INYEAFVKHIMSG
NT seq 582 nt   +upstreamnt  +downstreamnt
atgcctcccaagaaacccgagcctaagaaggagactgccaagccggctgcagcccctgct
ccagctgcatccgcagctccggagcccctcaaggactctgcctttgacccaaagagtgtg
aagatagacttcagtgctgaccagatcgaagaattcaaagaggccttttcattgtttgac
cggactccaacgggagagatgaagatcacctacgggcagtgtggggacgtgctgcgggcc
ctgggccagaaccccaccaacgcagaggtgctgcgcgttttgggcaaacccaagcctgaa
gagatgagttccaagacactggacttcgagatgttcctgcccatcctgcaacacatctcc
cgcaacaaggagcagggcacctatgaggacttcgtggaggggctgcgggtctttgacaaa
gaaagcaacggcacagtcatgggtgcagagcttcggcatgtccttgctaccctgggagag
aagatgagcgaggcagaggtggagcagctgttgtctgggcaggaggatgccaatggctgc
atcaactatgaagcctttgtcaagcacatcatgtctgggtaa

KEGG   Mus musculus (mouse): 17897
Entry
17897             CDS       T01002                                 

Symbol
Myl3, MLC1SB, MLC1s, MLC1v, Mylc, VLC1
Name
(RefSeq) myosin, light polypeptide 3
  KO
K12749  myosin light chain 3
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04260  Cardiac muscle contraction
mmu04261  Adrenergic signaling in cardiomyocytes
mmu04371  Apelin signaling pathway
mmu05410  Hypertrophic cardiomyopathy
mmu05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    17897 (Myl3)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    17897 (Myl3)
   04261 Adrenergic signaling in cardiomyocytes
    17897 (Myl3)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    17897 (Myl3)
   05414 Dilated cardiomyopathy
    17897 (Myl3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mmu04812]
    17897 (Myl3)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Myosins
     17897 (Myl3)
SSDB
Motif
Pfam: EF-hand_1 EF-hand_6 EF-hand_7 EF-hand_8 CAP_N
Other DBs
NCBI-GeneID: 17897
NCBI-ProteinID: NP_034989
MGI: 97268
Ensembl: ENSMUSG00000059741
Vega: OTTMUSG00000016497
UniProt: P09542
Position
9 F2; 9 60.69 cM
AA seq 204 aa
MAPKKPEPKKDDAKAAAPKAAPAPAAAPAAAPAAAPEPERPKEAEFDASKIKIEFTPEQI
EEFKEAFLLFDRTPKGEMKITYGQCGDVLRALGQNPTQAEVLRVLGKPKQEELNSKMMDF
ETFLPMLQHISKNKDTGTYEDFVEGLRVFDKEGNGTVMGAELRHVLATLGERLTEDEVEK
LMAGQEDSNGCINYEAFVKHIMAS
NT seq 615 nt   +upstreamnt  +downstreamnt
atggcccccaaaaagccagagcccaagaaggatgatgccaaagcggctgcccccaaagca
gctccagctcctgcggctgcacctgcagctgcacctgcggctgcaccagagcctgagcgc
cccaaggaagccgagtttgatgcctccaagattaagatcgagttcacacctgaacagatt
gaagagttcaaggaggccttcctgctgttcgaccgcacacccaagggcgagatgaagatc
acatacgggcagtgtggggatgtcctgcgggctctgggtcagaatcctacccaggcagag
gtgctccgtgtcctggggaagccaaaacaggaagagctcaattccaagatgatggatttt
gagacgttcctgcctatgctccagcacatctccaagaacaaggacactggcacgtacgag
gacttcgtggaggggctgcgggtcttcgacaaggagggcaacggcacggtcatgggtgca
gagctccgacacgtgctggccacgctgggtgagagactgacagaagatgaggtagagaaa
ctgatggctggtcaagaggactccaacggctgcatcaactatgaagcgtttgtgaagcat
atcatggcgagctga

KEGG   Mus musculus (mouse): 17906
Entry
17906             CDS       T01002                                 

Symbol
Myl2, Gm32672, MLC-2, MLC-2s/v, MLC-2v, Mlc2v, Mylpc
Name
(RefSeq) myosin, light polypeptide 2, regulatory, cardiac, slow
  KO
K10351  myosin regulatory light chain 2
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04260  Cardiac muscle contraction
mmu04261  Adrenergic signaling in cardiomyocytes
mmu04371  Apelin signaling pathway
mmu04510  Focal adhesion
mmu04530  Tight junction
mmu04670  Leukocyte transendothelial migration
mmu04810  Regulation of actin cytoskeleton
mmu05132  Salmonella infection
mmu05410  Hypertrophic cardiomyopathy
mmu05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    17906 (Myl2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    17906 (Myl2)
   04530 Tight junction
    17906 (Myl2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    17906 (Myl2)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    17906 (Myl2)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    17906 (Myl2)
   04261 Adrenergic signaling in cardiomyocytes
    17906 (Myl2)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    17906 (Myl2)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    17906 (Myl2)
   05414 Dilated cardiomyopathy
    17906 (Myl2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mmu04812]
    17906 (Myl2)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Myosins
     17906 (Myl2)
SSDB
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_8 EF-hand_5 EF-hand_11
Other DBs
NCBI-GeneID: 17906
NCBI-ProteinID: NP_034991
MGI: 97272
Ensembl: ENSMUSG00000013936
Vega: OTTMUSG00000024649
UniProt: P51667
Position
5; 5 F
AA seq 166 aa
MAPKKAKKRIEGGSSNVFSMFEQTQIQEFKEAFTIMDQNRDGFIDKNDLRDTFAALGRVN
VKNEEIDEMIKEAPGPINFTVFLTMFGEKLKGADPEETILNAFKVFDPEGKGSLKADYVR
EMLTTQAERFSKEEIDQMFAAFPPDVTGNLDYKNLVHIITHGEEKD
NT seq 501 nt   +upstreamnt  +downstreamnt
atggcaccaaagaaagccaagaagcggatagaaggcgggagctccaacgtgttctccatg
tttgagcagacccagatccaggagttcaaggaagccttcacaatcatggaccagaacaga
gacggcttcatcgacaagaatgacctaagggacacatttgctgccctaggacgagtgaac
gtgaaaaatgaagagatcgatgaaatgatcaaagaggctccaggtccaattaacttcacc
gtgttcctcacgatgtttggggagaaacttaaaggggctgatcctgaagagaccattctc
aacgcattcaaggtgtttgatcccgagggcaaagggtcactgaaggctgactatgtccgg
gagatgctgaccacacaagcagagaggttctccaaagaggagatcgaccagatgttcgca
gcctttccccctgacgtcaccggcaatcttgattataagaatttggtccacatcattacc
cacggagaagagaaggactga

DBGET integrated database retrieval system