KEGG   Mus musculus (mouse): 14651
Entry
14651             CDS       T01002                                 

Gene name
Hagh, BC019817, Gl, Glo, Glo-2, Glo2, Rs, Rsp29
Definition
(RefSeq) hydroxyacyl glutathione hydrolase
  KO
K01069  hydroxyacylglutathione hydrolase [EC:3.1.2.6]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00620  Pyruvate metabolism
mmu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    14651 (Hagh)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.6  hydroxyacylglutathione hydrolase
     14651 (Hagh)
SSDB
Motif
Pfam: HAGH_C Lactamase_B Lactamase_B_2
Other DBs
NCBI-GeneID: 14651
NCBI-ProteinID: NP_077246
MGI: 95745
Ensembl: ENSMUSG00000024158
Vega: OTTMUSG00000026374
UniProt: Q99KB8 G5E8T9
Position
17 A3.3; 17 12.53 cM
AA seq 309 aa
MVLGRGSLCLRSLSALGATCARRGLGQALLGLSLCHSDFRKNLTVQQDIMKVELLPALTD
NYMYLIIDEDTQEAAIVDPVQPQKVIEAAKKHRVKLTTVLTTHHHWDHAGGNEKLVKLEP
GLKVYGGDDRIGALTHKVTHLSTLQVGSLSVKCLSTPCHTSGHICYFVSKPGSSEPSAVF
TGDTLFVAGCGKFYEGTADEMYKALLEVLGRLPPDTKVYCGHEYTVNNLKFARHVEPGNA
AIQEKLAWAKEKYAIGEPTVPSTLAEEFTYNPFMRVKEKTVQQHAGETDPVTTMRAIRRE
KDQFKVPRD
NT seq 930 nt   +upstreamnt  +downstreamnt
atggtgctgggtcgcgggtcgctgtgtctccggagcctgtcagcgctgggagccacctgc
gcgcgccgtggtctgggtcaggccctgctgggactatctctgtgtcactcagacttcagg
aagaatctgactgtgcagcaagacataatgaaggttgaactactgcctgccctgactgac
aactacatgtacctgatcattgatgaggacacccaggaggccgccatcgtggacccagtg
caaccacagaaggttatagaagctgcgaaaaagcaccgtgtgaaactgaccacagtgctc
accactcaccaccactgggaccacgctggtgggaacgagaagctggtgaagctggagcct
gggctgaaggtttatggaggtgatgaccgcatcggagccttgactcacaaggtcacacac
ctctccacactgcaggtggggtctctcagtgtcaaatgcctgtcaacaccctgccatact
tcgggacacatctgttactttgtgagcaagcctgggagctcagagccttctgctgtgttc
acaggtgacacattgtttgttgctggctgtgggaagttctatgagggaactgcagatgag
atgtacaaggcgctgcttgaagtcttgggccggcttcctccagacacaaaagtctactgt
ggtcatgaatacaccgtaaacaaccttaagtttgcacgccatgtggagcccggcaatgct
gccattcaagagaaactagcctgggccaaggagaagtatgccatcggggagcccacggtg
ccatccaccctggcagaagagttcacctacaaccccttcatgagagtgaaggagaagact
gtgcaacagcatgctggcgagacagaccctgtgaccaccatgagggccatccgcagggag
aaggaccagttcaaggtgcctcgggactga

DBGET integrated database retrieval system