KEGG   Mus musculus (mouse): 14825
Entry
14825             CDS       T01002                                 

Gene name
Cxcl1, F, Fsp, Gr, Gro1, KC, Mg, Mgsa, N5, N51, Scyb, Scyb1, gro
Definition
(RefSeq) chemokine (C-X-C motif) ligand 1
  KO
K05505  C-X-C motif chemokine 1/2/3
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04061  Viral protein interaction with cytokine and cytokine receptor
mmu04062  Chemokine signaling pathway
mmu04064  NF-kappa B signaling pathway
mmu04621  NOD-like receptor signaling pathway
mmu04657  IL-17 signaling pathway
mmu04668  TNF signaling pathway
mmu05134  Legionellosis
mmu05146  Amoebiasis
mmu05167  Kaposi sarcoma-associated herpesvirus infection
mmu05323  Rheumatoid arthritis
mmu05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    14825 (Cxcl1)
   04668 TNF signaling pathway
    14825 (Cxcl1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    14825 (Cxcl1)
   04061 Viral protein interaction with cytokine and cytokine receptor
    14825 (Cxcl1)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    14825 (Cxcl1)
   04657 IL-17 signaling pathway
    14825 (Cxcl1)
   04062 Chemokine signaling pathway
    14825 (Cxcl1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    14825 (Cxcl1)
  09171 Infectious disease: bacterial
   05134 Legionellosis
    14825 (Cxcl1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    14825 (Cxcl1)
  09163 Immune disease
   05323 Rheumatoid arthritis
    14825 (Cxcl1)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    14825 (Cxcl1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    14825 (Cxcl1)
Cytokines and growth factors [BR:mmu04052]
 Cytokines
  Chemokines
   14825 (Cxcl1)
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 14825
NCBI-ProteinID: NP_032202
MGI: 108068
Ensembl: ENSMUSG00000029380
Vega: OTTMUSG00000016842
UniProt: P12850 A2RTH0
Position
5 E1; 5 44.78 cM
AA seq 96 aa
MIPATRSLLCAALLLLATSRLATGAPIANELRCQCLQTMAGIHLKNIQSLKVLPSGPHCT
QTEVIATLKNGREACLDPEAPLVQKIVQKMLKGVPK
NT seq 291 nt   +upstreamnt  +downstreamnt
atgatcccagccacccgctcgcttctctgtgcagcgctgctgctgctggccaccagccgc
ctggccacaggggcgcctatcgccaatgagctgcgctgtcagtgcctgcagaccatggct
gggattcacctcaagaacatccagagcttgaaggtgttgccctcagggccccactgcacc
caaaccgaagtcatagccacactcaagaatggtcgcgaggcttgccttgaccctgaagct
cccttggttcagaaaattgtccaaaagatgctaaaaggtgtccccaagtaa

KEGG   Mus musculus (mouse): 20310
Entry
20310             CDS       T01002                                 

Gene name
Cxcl2, CINC, CINC-2a, GROb, Gr, Gro2, MIP, MIP-2, MIP-2a, Mgsa, Mgsa-b, Mi, Mip2, Scy, Scyb, Scyb2
Definition
(RefSeq) chemokine (C-X-C motif) ligand 2
  KO
K05505  C-X-C motif chemokine 1/2/3
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04061  Viral protein interaction with cytokine and cytokine receptor
mmu04062  Chemokine signaling pathway
mmu04064  NF-kappa B signaling pathway
mmu04621  NOD-like receptor signaling pathway
mmu04657  IL-17 signaling pathway
mmu04668  TNF signaling pathway
mmu05134  Legionellosis
mmu05146  Amoebiasis
mmu05167  Kaposi sarcoma-associated herpesvirus infection
mmu05323  Rheumatoid arthritis
mmu05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    20310 (Cxcl2)
   04668 TNF signaling pathway
    20310 (Cxcl2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    20310 (Cxcl2)
   04061 Viral protein interaction with cytokine and cytokine receptor
    20310 (Cxcl2)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    20310 (Cxcl2)
   04657 IL-17 signaling pathway
    20310 (Cxcl2)
   04062 Chemokine signaling pathway
    20310 (Cxcl2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    20310 (Cxcl2)
  09171 Infectious disease: bacterial
   05134 Legionellosis
    20310 (Cxcl2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    20310 (Cxcl2)
  09163 Immune disease
   05323 Rheumatoid arthritis
    20310 (Cxcl2)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    20310 (Cxcl2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    20310 (Cxcl2)
Cytokines and growth factors [BR:mmu04052]
 Cytokines
  Chemokines
   20310 (Cxcl2)
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 20310
NCBI-ProteinID: NP_033166
MGI: 1340094
Ensembl: ENSMUSG00000058427
Vega: OTTMUSG00000055510
UniProt: P10889 Q3U1J5
Structure
PDB: 
3N52 1MI2

Position
5 E1; 5 44.78 cM
AA seq 100 aa
MAPPTCRLLSAALVLLLLLATNHQATGAVVASELRCQCLKTLPRVDFKNIQSLSVTPPGP
HCAQTEVIATLKGGQKVCLDPEAPLVQKIIQKILNKGKAN
NT seq 303 nt   +upstreamnt  +downstreamnt
atggcccctcccacctgccggctcctcagtgctgcactggtcctgctgctgctgctggcc
accaaccaccaggctacaggggctgttgtggccagtgaactgcgctgtcaatgcctgaag
accctgccaagggttgacttcaagaacatccagagcttgagtgtgacgcccccaggaccc
cactgcgcccagacagaagtcatagccactctcaagggcggtcaaaaagtttgccttgac
cctgaagcccccctggttcagaaaatcatccaaaagatactgaacaaaggcaaggctaac
tga

KEGG   Mus musculus (mouse): 330122
Entry
330122            CDS       T01002                                 

Gene name
Cxcl3, Dci, Dcip1, Gm1960
Definition
(RefSeq) chemokine (C-X-C motif) ligand 3
  KO
K05505  C-X-C motif chemokine 1/2/3
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04061  Viral protein interaction with cytokine and cytokine receptor
mmu04062  Chemokine signaling pathway
mmu04064  NF-kappa B signaling pathway
mmu04621  NOD-like receptor signaling pathway
mmu04657  IL-17 signaling pathway
mmu04668  TNF signaling pathway
mmu05134  Legionellosis
mmu05146  Amoebiasis
mmu05167  Kaposi sarcoma-associated herpesvirus infection
mmu05323  Rheumatoid arthritis
mmu05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    330122 (Cxcl3)
   04668 TNF signaling pathway
    330122 (Cxcl3)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    330122 (Cxcl3)
   04061 Viral protein interaction with cytokine and cytokine receptor
    330122 (Cxcl3)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    330122 (Cxcl3)
   04657 IL-17 signaling pathway
    330122 (Cxcl3)
   04062 Chemokine signaling pathway
    330122 (Cxcl3)
 09160 Human Diseases
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    330122 (Cxcl3)
  09171 Infectious disease: bacterial
   05134 Legionellosis
    330122 (Cxcl3)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    330122 (Cxcl3)
  09163 Immune disease
   05323 Rheumatoid arthritis
    330122 (Cxcl3)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    330122 (Cxcl3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    330122 (Cxcl3)
Cytokines and growth factors [BR:mmu04052]
 Cytokines
  Chemokines
   330122 (Cxcl3)
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 330122
NCBI-ProteinID: NP_976065
MGI: 3037818
Ensembl: ENSMUSG00000029379
Vega: OTTMUSG00000055506
UniProt: Q6W5C0
Position
5; 5 E1
AA seq 100 aa
MAPPTCRLLSAALVLLLLLATNHQATGAVVASELRCQCLNTLPRVDFETIQSLTVTPPGP
HCTQTEVIATLKDGQEVCLNPQGPRLQIIIKKILKSGKSS
NT seq 303 nt   +upstreamnt  +downstreamnt
atggcccctcccacctgccggctcctcagtgctgcactggtcctgctgctgctgctggcc
accaaccaccaggctacaggggctgttgtggccagtgagctgcgctgtcagtgcctgaac
accctaccaagggttgattttgagaccatccagagcttgacggtgacgcccccaggaccc
cactgcacccagacagaagtcatagccactctcaaggatggtcaagaagtttgcctcaac
ccccaaggccccaggcttcagataatcatcaagaagatactgaagagcggcaagtccagc
tga

DBGET integrated database retrieval system