KEGG   Mus musculus (mouse): 14884
Entry
14884             CDS       T01002                                 

Gene name
Gtf2h1, 62kD, 62kDa, AW743425, AW822074, BTF2_p62, C77871, p6, p62
Definition
(RefSeq) general transcription factor II H, polypeptide 1
  KO
K03141  transcription initiation factor TFIIH subunit 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03022  Basal transcription factors
mmu03420  Nucleotide excision repair
mmu05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09121 Transcription
   03022 Basal transcription factors
    14884 (Gtf2h1)
  09124 Replication and repair
   03420 Nucleotide excision repair
    14884 (Gtf2h1)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    14884 (Gtf2h1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:mmu03021]
    14884 (Gtf2h1)
   03400 DNA repair and recombination proteins [BR:mmu03400]
    14884 (Gtf2h1)
Transcription machinery [BR:mmu03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     14884 (Gtf2h1)
DNA repair and recombination proteins [BR:mmu03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TFIIH complex
     14884 (Gtf2h1)
SSDB
Motif
Pfam: PH_TFIIH BSD
Other DBs
NCBI-GeneID: 14884
NCBI-ProteinID: NP_032212
MGI: 1277216
Ensembl: ENSMUSG00000006599
Vega: OTTMUSG00000024398
UniProt: Q9DBA9 G3X8R4 Q7TPY0
Position
7; 7 B3
AA seq 547 aa
MATSSEEVLLIVKKVRQKKQDGALYLMAERIAWAPEGKDRFTISHMYADIKCQKISPEGK
AKIQLQLVLHAGDTTNFHFSNESTAVKERDAVKDLLQQLLPKFKRKANKELEEKNRMLQE
DPVLFQLYKDLVVSQVISAEEFWANRLNVNATDSSTSSHKQDVGISAAFLADVRPQTDGC
NGLRYNLTSDIIESIFRTYPAVKMKYAETVPHNMTEKEFWTRFFQSHYFHRDRLNTGSKD
LFAECAKIDEKGLKTMVSLGVKNPMLDLTSLEDKPLDEGYGISSVPSTSNSKSIKENSNA
AIIKRFNHHSAMVLAAGLRKQQAQNGQNGEPSSVDGNSGDTDCFQPAVKRAKLQESIEYE
DLGNNNSVKTIALNLKKSDRYYHGPTPIQSLQYATSQDIINSFQSIRQEMEAYTPKLTQV
LSSSAASSTITALSPGGALMQGGTQQAVNQMVPNDIQSELKHLYVAVGELLRHFWSCFPV
NTPFLEEKVVKMKSNLERFQVTKLCPFQEKIRRQYLSTNLVSHIEEMLQTAYNKLHAWQS
RRLMKKT
NT seq 1644 nt   +upstreamnt  +downstreamnt
atggcgacttcatcagaagaagtgttgctgattgtgaagaaggttcgtcagaagaagcag
gatggagcactgtacctcatggcagagagaattgcttgggcacctgaaggcaaagacaga
tttacaatcagccatatgtatgcagatattaaatgccagaaaatcagtccagagggaaaa
gctaaaatacaacttcagctggtcctgcatgcaggggacacaacaaacttccatttttcc
aacgaaagcacggcagtgaaagaacgggatgcagtgaaggacctccttcagcagctgctg
cccaagttcaagcggaaagctaataaagagctggaggagaagaacagaatgctccaagaa
gatcctgttttattccaactctataaagaccttgttgtgagccaagtgatcagtgctgag
gaattctgggccaatcgtttaaatgtgaatgcaacagatagttctacatccagtcacaag
caggatgttggtatttctgcagcatttctggctgatgtccggccccaaacggatggctgt
aatggtctgagatataatttaacttctgatatcattgaatctatatttaggacctatcca
gcagtaaaaatgaaatatgcagaaactgtaccacacaacatgacagaaaaggagttctgg
acacgctttttccagtcccattattttcacagggaccgactaaatacaggatcgaaggac
ctctttgcagaatgtgccaaaatagatgagaagggattaaaaacaatggtttcattagga
gtgaaaaacccaatgctagatttgacatcgttggaagataagccattagacgagggctat
ggcatttcctctgtgccatctacttccaattccaaatccataaaggagaatagtaatgct
gccatcatcaaaaggtttaaccaccacagtgccatggtcctggctgctggtctcaggaaa
caacaagcacaaaatggacagaatggtgagcccagcagcgtggatgggaattctggggat
acagactgctttcagccagcagtcaaaagggcaaagttgcaggagtccattgaatatgaa
gacttgggaaacaacaattctgtgaaaacgattgcactgaatctcaagaagtcagacagg
tattaccatggtcctactccaattcagtcactgcagtatgcaacaagtcaggacattatt
aactcttttcaaagtattagacaagaaatggaagcttacacacccaagttaactcaggtt
ctctcaagcagtgctgctagtagcaccatcacagccctgtcacctggaggagctcttatg
cagggagggacacagcaagccgtaaaccagatggtgccaaacgatattcagtctgaattg
aaacacttgtatgtggctgttggggaacttctgcggcatttttggtcttgctttcctgtt
aatacaccattcctagaagaaaaggtagtgaaaatgaagagtaatttggaacggttccaa
gttacaaagctctgcccattccaagaaaagattcggaggcagtatttaagcacaaatctg
gtaagtcacatagaagagatgctgcagacagcctacaacaagctccacgcgtggcaatcc
cggcgcctgatgaagaagacgtga

DBGET integrated database retrieval system