KEGG   Mus musculus (mouse): 14885
Entry
14885             CDS       T01002                                 

Gene name
Gtf2h4, AW545633, BTF2_p52, p5, p52
Definition
(RefSeq) general transcription factor II H, polypeptide 4
  KO
K03144  transcription initiation factor TFIIH subunit 4
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03022  Basal transcription factors
mmu03420  Nucleotide excision repair
mmu05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09121 Transcription
   03022 Basal transcription factors
    14885 (Gtf2h4)
  09124 Replication and repair
   03420 Nucleotide excision repair
    14885 (Gtf2h4)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    14885 (Gtf2h4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:mmu03021]
    14885 (Gtf2h4)
   03400 DNA repair and recombination proteins [BR:mmu03400]
    14885 (Gtf2h4)
Transcription machinery [BR:mmu03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     14885 (Gtf2h4)
DNA repair and recombination proteins [BR:mmu03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TFIIH complex
     14885 (Gtf2h4)
SSDB
Motif
Pfam: Tfb2 Tfb2_C Helicase_C_3
Other DBs
NCBI-GeneID: 14885
NCBI-ProteinID: NP_034494
MGI: 1338799
Ensembl: ENSMUSG00000001524
Vega: OTTMUSG00000034602
UniProt: O70422 Q542U3
Position
17; 17 B1
AA seq 463 aa
MEITPARGGLNRAHLQCRNLQEFLGGLSPGVLDRLYGHPATCLAVFRELPSLAKNWVMRM
LFLEQPLPQAAVALWVKKEFSKAQEESTGLLSGLRIWHTQLLPGGLQGLILNPVFRQNLR
IALLGGGKAWSDDTSQLGPDKHARDVPSLDKYAEERWEVVLHFMVGSPSAAVSQDLAQLL
SQAGLMKSTEPGEPPCITSAGFQFLLLDTPAQLWYFMLQYLQTAQSRGMDLVEILSFLFQ
LSFSTLGKDYSVEGMSDSLLNFLQHLREFGLVFQRKRKSRRYYPTRLAINLSSGVSGAGG
TVHQPGFIVVETNYRLYAYTESELQIALIALFSEMLYRFPNMVVAQVTRESVQQAIASGI
TAQQIIHFLRTRAHPVMLKQNPVLPPTITDQIRLWELERDRLRFTEGVLYNQFLSQVDFE
LLLAHARELGVLVFENSAKRLMVVTPAGHSDVKRFWKRQKHSS
NT seq 1392 nt   +upstreamnt  +downstreamnt
atggagatcaccccggcgaggggtggactgaaccgagcacacctacaatgcaggaatctc
caggagttcttaggaggcctgagccctggggtgctggaccgattgtatgggcaccctgcc
acttgtctggctgtcttcagggagctcccctctttggctaagaactgggtcatgaggatg
ctctttctggagcagccgctaccacaggctgcggtggccctgtgggtgaagaaggagttc
agcaaggctcaggaggaaagtacggggctgctgagtggcctccgtatctggcatacccag
ctgctccctggtggactccaaggcctcatcttgaaccccgtcttccgccagaacctccga
attgcccttctgggtgggggcaaggcctggtctgatgacacaagtcagctgggaccagac
aagcatgcccgggacgtcccctcactggacaagtatgctgaggagcgctgggaggtggtc
ttgcacttcatggtgggctcccccagtgcagctgtcagccaagacctggctcagctcctc
agccaggccgggcttatgaaaagcactgaacctggagagccaccctgcatcacttccgct
ggcttccagttcctgctactggacacgcctgcccagctctggtacttcatgctgcagtat
ctgcagacagcccagagccggggcatggatctggtggagattctctccttccttttccag
ctcagcttctccactcttggcaaggactactctgtggaggggatgagtgactctttgttg
aacttcctgcaacacctgcgtgagttcgggcttgttttccagaggaagaggaagtcccgg
cgttactaccccacacgcctggccatcaacctctcatctggtgtctctggggctgggggc
actgtgcaccagccaggcttcattgtcgtggaaactaattaccgactgtacgcctatacc
gagtcggaactgcagatcgctctcattgcccttttctccgaaatgctctatcgattcccc
aacatggtggtggcacaagtgacccgggagagtgtgcagcaggccattgctagtggcatc
acagctcagcagataatccatttcctaaggacaagggcacatccagtgatgctcaaacag
aatcctgtgctgccccccaccataacagaccagattcggctgtgggagctggaaagggac
agactccggttcactgaaggcgtcctgtataaccagttcctgtcgcaagtggactttgaa
ctgctgctggcccacgcgcgggagctgggcgtgcttgtgttcgagaactcggccaagcgg
ctgatggtggtgacgccggcagggcacagcgacgtcaagcgcttctggaagcggcagaag
cacagctcctga

DBGET integrated database retrieval system