KEGG   Mus musculus (mouse): 15107
Entry
15107             CDS       T01002                                 

Gene name
Hadh, AA409008, AU019341, AW742602, HCDH, Hadhsc, Sch, Schad
Definition
(RefSeq) hydroxyacyl-Coenzyme A dehydrogenase
  KO
K00022  3-hydroxyacyl-CoA dehydrogenase [EC:1.1.1.35]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00062  Fatty acid elongation
mmu00071  Fatty acid degradation
mmu00280  Valine, leucine and isoleucine degradation
mmu00310  Lysine degradation
mmu00380  Tryptophan metabolism
mmu00650  Butanoate metabolism
mmu01100  Metabolic pathways
mmu01212  Fatty acid metabolism
Module
mmu_M00032  Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
mmu_M00085  Fatty acid elongation in mitochondria
mmu_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    15107 (Hadh)
  09103 Lipid metabolism
   00062 Fatty acid elongation
    15107 (Hadh)
   00071 Fatty acid degradation
    15107 (Hadh)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    15107 (Hadh)
   00310 Lysine degradation
    15107 (Hadh)
   00380 Tryptophan metabolism
    15107 (Hadh)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     15107 (Hadh)
SSDB
Motif
Pfam: 3HCDH_N 3HCDH Pyr_redox_2 Pyr_redox NAD_Gly3P_dh_N NAD_binding_2 AlaDh_PNT_C DAO UDPG_MGDP_dh_N F420_oxidored NAD_binding_7 GIDA NAD_binding_8 Sacchrp_dh_NADP 2-Hacid_dh_C XdhC_C TrkA_N FAD_binding_3 FAD_oxidored
Other DBs
NCBI-GeneID: 15107
NCBI-ProteinID: NP_032238
MGI: 96009
Ensembl: ENSMUSG00000027984
Vega: OTTMUSG00000028850
UniProt: Q61425
Position
3; 3 G3
AA seq 314 aa
MAFVTRQFLRSMSSSSSASAAAKKILIKHVTVIGGGLMGAGIAQVAAATGHTVVLVDQTE
DILAKSKKGIEESLKRMAKKKFTENPKAGDEFVEKTLSCLSTSTDAASVVHSTDLVVEAI
VENLKLKNELFQRLDKFAAEHTIFASNTSSLQITNIANATTRQDRFAGLHFFNPVPMMKL
VEVIKTPMTSQKTFESLVDFCKTLGKHPVSCKDTPGFIVNRLLVPYLIEAVRLHERGDAS
KEDIDTAMKLGAGYPMGPFELLDYVGLDTTKFILDGWHEMEPENPLFQPSPSMNNLVAQK
KLGKKTGEGFYKYK
NT seq 945 nt   +upstreamnt  +downstreamnt
atggcgttcgtgaccaggcaattcttgcgctccatgtcctcctcttcctctgcgtcggcg
gccgccaagaagatcctgatcaagcatgtgaccgtcatcggcggcgggctgatgggcgcc
ggcatcgcgcaggtagctgcagcaactggccatacagtagtattggtggaccaaacggaa
gacatcctggcaaaatccaagaagggaattgaggagagtctaaagaggatggcaaagaag
aagttcacagaaaaccctaaggctggagatgagtttgtggagaagaccctgagctgcctt
tcaaccagcaccgatgcggcatccgtggtgcacagcacagacctggtggtggaggccatt
gtggagaacctgaagctgaagaacgagctgttccagaggctggacaagttcgctgcagaa
cacaccatctttgccagcaacacgtcttctttgcagatcacaaacatagccaatgccacc
accagacaagaccgatttgctggcctccactttttcaaccccgtgcctatgatgaagctt
gtggaggtcatcaaaacaccgatgaccagccagaagacatttgaatctctggtggacttt
tgtaaaaccttaggaaagcatcctgtctcttgcaaggacactcctggattcatcgtgaac
cgactcttggtgccatacctcattgaggccgtcaggctacacgagcgaggcgatgcgtct
aaggaagacatcgatacagcgatgaagctgggagctgggtatcccatgggtccgtttgag
cttcttgactatgttggactggatactacaaagttcatcttggacgggtggcatgaaatg
gagccagagaaccccttatttcagcccagtccttccatgaataatctggtggcccagaag
aagctgggcaagaagaccggagaaggattttacaaatacaagtga

KEGG   Mus musculus (mouse): 74147
Entry
74147             CDS       T01002                                 

Gene name
Ehhadh, 1300002P22Rik, HD, L-P, L-PBE, LBFP, LBP, MF, MFE1, MFP, MFP-1, MFP1, PBFE
Definition
(RefSeq) enoyl-Coenzyme A, hydratase/3-hydroxyacyl Coenzyme A dehydrogenase
  KO
K07514  enoyl-CoA hydratase / 3-hydroxyacyl-CoA dehydrogenase / 3,2-trans-enoyl-CoA isomerase [EC:4.2.1.17 1.1.1.35 5.3.3.8]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00071  Fatty acid degradation
mmu00280  Valine, leucine and isoleucine degradation
mmu00310  Lysine degradation
mmu00380  Tryptophan metabolism
mmu00410  beta-Alanine metabolism
mmu00640  Propanoate metabolism
mmu00650  Butanoate metabolism
mmu01100  Metabolic pathways
mmu01212  Fatty acid metabolism
mmu03320  PPAR signaling pathway
mmu04146  Peroxisome
Module
mmu_M00032  Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
mmu_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    74147 (Ehhadh)
   00650 Butanoate metabolism
    74147 (Ehhadh)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    74147 (Ehhadh)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    74147 (Ehhadh)
   00310 Lysine degradation
    74147 (Ehhadh)
   00380 Tryptophan metabolism
    74147 (Ehhadh)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    74147 (Ehhadh)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    74147 (Ehhadh)
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    74147 (Ehhadh)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     74147 (Ehhadh)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     74147 (Ehhadh)
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  Delta3-Delta2-enoyl-CoA isomerase
     74147 (Ehhadh)
SSDB
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 UDPG_MGDP_dh_N NAD_binding_2 TrkA_N Peptidase_S49 2-Hacid_dh_C F420_oxidored ApbA Methyltransf_11 DUF6174
Other DBs
NCBI-GeneID: 74147
NCBI-ProteinID: NP_076226
MGI: 1277964
Ensembl: ENSMUSG00000022853
Vega: OTTMUSG00000033863
UniProt: Q9DBM2
Position
16; 16 B1
AA seq 718 aa
MAEYLRLPHSLAMIRLCNPPVNAISPTVITEVRNGLQKASLDHTVRAIVICGANDNFCAG
ADIHGFKSPTGLTLGSLVDEIQRYQKPVVAAIQGVALGGGLELALGCHYRIANAKARVGF
PEVMLGILPGARGTQLLPRVVGVPVALDLITSGRHISTDEALKLGILDVVVKSDPVEEAI
KFAQTVIGKPIEPRRILNKPVPSLPNMDSVFAEAIAKVRKQYPGRLAPETCVRSVQASVK
HPYEVAIKEEAKLFMYLRGSGQARALQYAFFAEKSANKWSTPSGASWKTASAQPVSSVGV
LGLGTMGRGIAISFARVGIPVVAVESDPKQLDTAKKIITSTLEKEASKSGQASAKPNLRF
SSSTKELSSVDLVIEAVFEDMNLKKKVFAELSALCKPGAFLCTNTSALDVDDIASSTDRP
QLVIGTHFFSPAHIMRLLEVIPSRYSSPTTIATVMSLSKRIGKIGVVVGNCYGFVGNRML
APYYNQGYFLIEEGSKPEDVDGVLEEFGFRMGPFRVSDLAGLDVGWKVRKGQGLTGPSLP
PGTPTRKRGNTRYSPIADMLCEAGRFGQKTGKGWYQYDKPLGRIHKPDPWLSEFLSQYRE
THHIKQRSISKEEILERCLYSLINEAFRILEEGMAASPEHIDVIYLHGYGWPRHVGGPMY
YAASVGLPTVLEKLQKYYRQNPDIPQLEPSDYLRRLVAQGSPPLKEWQSLAGPHSSKL
NT seq 2157 nt   +upstreamnt  +downstreamnt
atggctgagtatctgaggctgccccactccctggctatgatccgcctctgcaatccaccg
gtcaatgccatcagtccaactgtaatcacagaagtaaggaatggactccagaaagctagt
ttggaccatacggttagagccatagtgatctgtggagcaaatgacaacttctgtgcaggt
gctgatatccatggctttaaatctcccactggccttacattaggaagcttggtagatgaa
atacagcgataccagaagccagtggtggccgccatccaaggcgtggctcttggaggagga
ctagagctggccttgggctgtcactatcggattgccaatgcaaaggctcgtgttggcttc
ccggaagtgatgctgggaattcttcctggtgcaagaggaacgcagcttctacccagggtc
gttggagttcctgttgctcttgacttaattacctcaggaagacatatttcaacagatgaa
gcactcaagcttggaattctggatgtagttgtaaagtcagacccagttgaagaagccatc
aaatttgctcagacggttataggtaaacccatagaaccccgcaggatcctaaacaagcca
gtcccaagcttgcccaacatggacagtgtttttgcagaagccattgccaaggtacggaag
cagtaccctggccgcctggctccggagacttgtgtccgttcagtccaggcctccgtgaag
catccatatgaagtggccatcaaggaagaagcaaagctgtttatgtaccttcgggggtcg
gggcaggctagagccctgcagtacgccttttttgctgaaaagtctgcaaataagtggtca
actccctcaggagcatcttggaaaacagcatctgctcaacccgtctcctcggttggtgtt
cttggcttgggaacgatgggccgaggcatcgccatctcttttgcaagggtggggatccct
gtggttgctgtagagtcagacccaaagcagctagatactgcaaagaagataataacttcc
accttggaaaaggaagcatcgaagagtggccaagcttcagcaaaaccaaacctcaggttc
tcctcatccacaaaggagctttcgagtgtggatttagtgattgaagcagtgttcgaagat
atgaacctgaagaagaaggtcttcgctgaactgtcagccctgtgcaagccgggagccttt
ctgtgcaccaatacctcagcactggatgtggatgacattgcttcttccacagatcgcccc
cagctggtgattggcacccacttcttctccccagcccacatcatgaggttactagaggtc
attcctagccgatactcttcccccactaccatcgccacagtcatgagcttatccaaaagg
attggaaagattggagtcgttgttggtaactgctatggatttgttgggaatcgaatgttg
gctccctattacaaccagggctatttcttgatagaggaaggtagtaagccagaggatgta
gatggggtcttagaagagtttggttttagaatgggacccttcagggtgtctgacctcgca
gggctagatgtgggttggaaagttcgcaaagggcaaggccttactggaccgtccttacct
ccaggaacccccacccgaaagaggggcaataccaggtactccccaattgctgatatgctc
tgtgaagctgggcgatttggtcagaagacaggtaagggctggtatcagtatgacaagcca
ctgggtcgcatccacaaacctgatccctggctttctgagtttctgtcacagtatagagaa
acccatcacatcaagcagcgctccatcagcaaggaggaaatcctggagcgttgcttatat
tcccttatcaacgaggcattccgcatcttggaggaggggatggccgctagcccagagcac
attgatgtcatctacttgcatgggtatgggtggccaaggcacgtgggtgggcccatgtac
tatgctgcctcagttgggctgcccacagttctagagaaattgcagaaatattacagacag
aatcctgacatcccccagctggagcccagtgactacctgaggaggctggttgcccaggga
agccctcctctgaaagaatggcaaagcttggcaggaccccatagcagcaaactgtga

DBGET integrated database retrieval system