KEGG   Mus musculus (mouse): 15242
Entry
15242             CDS       T01002                                 

Gene name
Hhex, Hex, Hex1, Hhex-r, Hhex-rs2, Pr, Prh, Prhx
Definition
(RefSeq) hematopoietically expressed homeobox
  KO
K08024  homeobox protein HEX
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04950  Maturity onset diabetes of the young
mmu05202  Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    15242 (Hhex)
  09167 Endocrine and metabolic disease
   04950 Maturity onset diabetes of the young
    15242 (Hhex)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    15242 (Hhex)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain ANTP: NKL
    15242 (Hhex)
SSDB
Motif
Pfam: Homeodomain Homeobox_KN
Other DBs
NCBI-GeneID: 15242
NCBI-ProteinID: NP_032271
MGI: 96086
Ensembl: ENSMUSG00000024986
Vega: OTTMUSG00000021162
UniProt: P43120
Position
19 C2; 19 32.28 cM
AA seq 271 aa
MQFPHPGPAAAPAVGVPLYAPTPLLQPAHPTPFYIDDILGRGPAAPTPTPTLPSPNSSFT
SLVSSYRTPVYEPTPVHPAFSHHPAAALAAAYGPSGFGGPLYPFPRTVNDYTHALLRHDP
LGKPLLWSPFLQRPLHKRKGGQVRFSNDQTVELEKKFETQKYLSPPERKRLAKMLQLSER
QVKTWFQNRRAKWRRLKQENPQSNKKDALDSLDTSCEQGQDLPSEQNKGASLDRSQCSPS
PASQEDPDSEISEDSDQEVDIEGDKGYFNAG
NT seq 816 nt   +upstreamnt  +downstreamnt
atgcagttcccgcacccggggcccgcggctgcgcccgccgtgggagtcccgctgtatgcg
cccacgccgctgctgcagcccgctcacccgacgcccttctacatcgacgacatcttgggt
cgcgggcccgccgcccccacgcccactcccacgctgccgtcccccaactcctccttcacc
agcctcgtgtcctcctaccggaccccggtgtacgagcccacgccggtccaccccgccttc
tcgcaccacccggccgccgcgctggccgccgcctacggccccagtggcttcggaggccct
ctgtacccgttcccgcggacggtgaacgactacacgcacgccctactccgccacgacccc
ctgggcaagcccttgctctggagccccttcctccagcgacctctgcacaaaaggaaaggc
ggtcaagtgaggttctccaacgaccagaccgtcgagctggagaagaagttcgagactcag
aaatacctctccccacccgagagaaagcgtctggccaagatgttacagctcagtgagaga
caggtcaaaacctggtttcagaatcgccgagctaaatggagaagactgaaacaggagaat
cctcaaagcaacaaaaaggatgcgttggacagtttggacacttcctgtgagcagggtcaa
gacttgcccagtgaacagaataaaggtgcctctttggatcgttcgcagtgttcaccctcc
ccagcctctcaggaagaccccgactcggagatctcagaggattccgaccaggaggtggac
atcgagggggataaaggctactttaatgctggatga

DBGET integrated database retrieval system