KEGG   Mus musculus (mouse): 15360
Entry
15360             CDS       T01002                                 

Gene name
Hmgcs2, 1300002P16, mH, mHS
Definition
(RefSeq) 3-hydroxy-3-methylglutaryl-Coenzyme A synthase 2
  KO
K01641  hydroxymethylglutaryl-CoA synthase [EC:2.3.3.10]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00072  Synthesis and degradation of ketone bodies
mmu00280  Valine, leucine and isoleucine degradation
mmu00650  Butanoate metabolism
mmu00900  Terpenoid backbone biosynthesis
mmu01100  Metabolic pathways
mmu03320  PPAR signaling pathway
Module
mmu_M00095  C5 isoprenoid biosynthesis, mevalonate pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    15360 (Hmgcs2)
  09103 Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    15360 (Hmgcs2)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    15360 (Hmgcs2)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    15360 (Hmgcs2)
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    15360 (Hmgcs2)
Enzymes [BR:mmu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.10  hydroxymethylglutaryl-CoA synthase
     15360 (Hmgcs2)
SSDB
Motif
Pfam: HMG_CoA_synt_C HMG_CoA_synt_N ACP_syn_III
Other DBs
NCBI-GeneID: 15360
NCBI-ProteinID: NP_032282
MGI: 101939
Ensembl: ENSMUSG00000027875
Vega: OTTMUSG00000026370
UniProt: P54869
Position
3 F2.2; 3 42.74 cM
AA seq 508 aa
MQRLLAPARRVLQVKRAMQETSLTPAHLLSAAQQRFSTIPPAPLAKTDTWPKDVGILALE
VYFPAQYVDQTDLEKFNNVEAGKYTVGLGQTRMGFCSVQEDINSLCLTVVQRLMERTKLP
WDAVGRLEVGTETIIDKSKAVKTVLMELFQDSGNTDIEGIDTTNACYGGTASLFNAANWM
ESSYWDGRYALVVCGDIAVYPSGNARPTGGAGAVAMLIGPKAPLVLEQGLRGTHMENAYD
FYKPNLASEYPLVDGKLSIQCYLRALDRCYAAYRKKIQNQWKQAGNNQPFTLDDVQYMIF
HTPFCKMVQKSLARLMFNDFLSSSSDKQNNLYKGLEAFRGLKLEETYTNKDVDKALLKAS
LDMFNQKTKASLYLSTNNGNMYTSSLYGCLASLLSHHSAQELAGSRIGAFSYGSGLAASF
FSFRVSKDASPGSPLEKLVSSVSDLPKRLDSRRRMSPEEFTEIMNQREQFYHKVNFSPPG
DTSNLFPGTWYLERVDEMHRRKYARCPV
NT seq 1527 nt   +upstreamnt  +downstreamnt
atgcagcggcttttggctccagcgaggcgggtcctgcaagtgaagagagcgatgcaggaa
acttcgctcacacctgctcacctgctctcagcagcccagcagaggttttctacaatccct
cctgctcccctggccaaaacagatacatggccaaaagatgtgggcatccttgccctggag
gtctattttccagcccaatatgtggaccaaactgacctggaaaagttcaacaatgtggaa
gcagggaagtatacagtgggcttgggccagacccgtatgggcttctgttcagtccaggag
gacatcaactccctgtgcctgacagtggtacagaggctgatggaacgcacaaagctgccg
tgggatgctgtgggccgtctggaagtgggcaccgagaccatcattgacaagtccaaggct
gtcaaaacagtgctcatggaactgttccaggattcaggcaacactgacatcgagggcata
gataccaccaacgcctgttatggcggcacagcctccctcttcaatgctgccaactggatg
gagtccagctactgggatggtcgctatgccctggtggtctgtggtgacattgcagtctac
ccgagtggtaacgcccgccccacaggtggtgctggggctgtggcaatgctgatcgggccc
aaggcccctctggtcctcgagcaagggctgaggggaactcacatggagaacgcgtacgac
ttctacaaaccaaacttggcctcagagtatccactggtggatgggaagctgtctatccag
tgctacctgcgggccttggatcgatgctatgcagcctaccgcaagaagatccagaatcag
tggaagcaagctggaaacaaccagcctttcaccctcgatgatgtgcagtatatgatcttc
cacacacccttttgcaagatggtccagaaatccctggctcggttgatgttcaatgacttc
ctgtcatccagcagtgacaaacagaacaacttatacaagggcctagaggccttcaggggt
ctaaagctggaagaaacctacaccaacaaggatgtagacaaggctcttttgaaggcctcc
ctggacatgttcaaccagaagaccaaggcctccctttacctctccacaaataatgggaac
atgtacacctcttccctctatggctgcctggcctcacttctctctcaccactctgcccaa
gaattggctggctccaggattggagccttctcctacggctcaggcttagcagcaagtttc
ttttcattccgagtgtccaaggatgcttccccaggttcccccctggagaaactggtgtct
agtgtgtcagatctgcccaaacgtctagactcccggagacgcatgtcccctgaggaattc
acagaaataatgaaccagagagagcaattttaccacaaggtgaacttctctccacctgga
gacacaagcaatctcttcccaggtacttggtaccttgaacgagtggatgagatgcatcgc
aggaagtatgcccggtgtcccgtctaa

KEGG   Mus musculus (mouse): 208715
Entry
208715            CDS       T01002                                 

Gene name
Hmgcs1, B130032C06Rik
Definition
(RefSeq) 3-hydroxy-3-methylglutaryl-Coenzyme A synthase 1
  KO
K01641  hydroxymethylglutaryl-CoA synthase [EC:2.3.3.10]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00072  Synthesis and degradation of ketone bodies
mmu00280  Valine, leucine and isoleucine degradation
mmu00650  Butanoate metabolism
mmu00900  Terpenoid backbone biosynthesis
mmu01100  Metabolic pathways
mmu03320  PPAR signaling pathway
Module
mmu_M00095  C5 isoprenoid biosynthesis, mevalonate pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    208715 (Hmgcs1)
  09103 Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    208715 (Hmgcs1)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    208715 (Hmgcs1)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    208715 (Hmgcs1)
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    208715 (Hmgcs1)
Enzymes [BR:mmu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.10  hydroxymethylglutaryl-CoA synthase
     208715 (Hmgcs1)
SSDB
Motif
Pfam: HMG_CoA_synt_C HMG_CoA_synt_N
Other DBs
NCBI-GeneID: 208715
NCBI-ProteinID: NP_001278368
MGI: 107592
Ensembl: ENSMUSG00000093930
UniProt: Q8JZK9
Position
13 D2.3; 13
AA seq 520 aa
MPGSLPLNAEACWPKDVGIVALEIYFPSQYVDQAELEKYDGVDAGKYTIGLGQARMGFCT
DREDINSLCLTVVQKLMERHSLSYDCIGRLEVGTETIIDKSKSVKSNLMQLFEESGNTDI
EGIDTTNACYGGTAAVFNAVNWVESSSWDGRYALVVAGDIAIYATGNARPTGGVGAVALL
IGPNAPLIFDRGLRGTHMQHAYDFYKPDMLSEYPVVDGKLSIQCYLSALDRCYSVYRKKI
RAQWQKEGKDKDFTLNDFGFMIFHSPYCKLVQKSLARMFLNDFLNDQNRDKNSIYSGLEA
FGDVKLEDTYFDRDVEKAFMKASSELFNQKTKASLLVSNQNGNMYTSSVYGSLASVLAQY
SPQQLAGKRVGVFSYGSGLAATLYSLKVTQDATPGSALDKITASLCDLKSRLDSRTCVAP
DVFAENMKLREDTHHLANYIPQCSIDSLFEGTWYLVRVDEKHRRTYARRPFTNDHSLDEG
MGLVHSNTATEHIPSPAKKVPRLPATSAESESAVISNGEH
NT seq 1563 nt   +upstreamnt  +downstreamnt
atgcctgggtcacttcctttgaatgcagaggcttgctggccaaaagatgtgggaatcgtt
gcccttgaaatctactttccttctcaatatgtcgatcaagctgagttggaaaaatacgat
ggtgtagatgctggaaagtataccatcggcctgggccaggccaggatgggcttctgcacg
gatcgtgaagacatcaactctctttgcctgactgtggttcagaaactgatggagagacat
agcctttcctatgattgcattgggcggctagaagttggaacagagacaatcatcgacaaa
tcgaaatcagtgaagtctaatttgatgcagctgtttgaggagtctgggaatacagatata
gaaggaatagatacaaccaatgcatgctatgggggcacagctgcagtcttcaatgccgtg
aactgggtcgaatccagctcttgggatggacgatatgctctggtagttgcaggagacatt
gctatatatgccacaggaaatgccagacctacaggtggagttggagctgtggccctgcta
attgggccaaacgctcctctaatttttgaccgagggctccgtgggacacacatgcagcat
gcctatgacttttacaagcctgacatgctctccgagtaccctgtggtcgacggaaagctc
tccatacagtgctacctcagcgccctggaccgctgctattctgtctaccgcaaaaagatc
cgtgcccagtggcagaaagagggaaaggataaagattttaccctgaatgattttggcttc
atgatctttcactcaccatattgtaaactggtgcagaaatctctagctcggatgttcctg
aatgactttcttaatgatcaaaacagagataaaaacagtatttacagtggactggaagcc
tttggggacgttaaattagaagatacttactttgacagagatgtagaaaaggcatttatg
aaggctagttctgagctattcaaccagaaaacaaaggcgtctttgcttgtgtctaatcag
aatggaaatatgtacacatcctctgtctatggttccctggcttctgtcctggcacagtac
tcacctcagcagttggcagggaagagggttggagtgttctcttacggttctggcttggct
gccacgctgtactcccttaaagtcacacaagacgccacaccaggatctgcccttgataaa
ataacagcaagtttatgtgaccttaaatcaaggcttgactcgagaacttgtgtggcaccg
gatgtctttgctgaaaacatgaagctcagagaggacacacatcacttagccaactatatt
ccccagtgttcaatagactcactctttgaaggaacgtggtatctggtcagagtggatgaa
aaacacagaaggacttacgcccggcgccccttcacaaatgaccacagtttggatgaagga
atggggctcgtgcatagtaacacagcaacagagcatattccaagccctgctaagaaagtg
ccaagactccctgcaacctcggccgaatctgaatcagctgtcatcagtaacggggagcac
tga

DBGET integrated database retrieval system