KEGG   Mus musculus (mouse): 15464
Entry
15464             CDS       T01002                                 

Symbol
Hrc
Name
(RefSeq) histidine rich calcium binding protein
  KO
K23450  sarcoplasmic reticulum histidine-rich calcium-binding protein
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04020  Calcium signaling pathway
mmu04260  Cardiac muscle contraction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    15464 (Hrc)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    15464 (Hrc)
SSDB
Motif
Pfam: Hist_rich_Ca-bd
Other DBs
NCBI-GeneID: 15464
NCBI-ProteinID: NP_034603
MGI: 96226
Ensembl: ENSMUSG00000038239
Vega: OTTMUSG00000023829
UniProt: Q9WVE4 G5E8J6
Position
7 B3; 7 29.26 cM
AA seq 738 aa
MGFQGPWLHTCLLWATVAILLVPPVVTQELRGAGLGLGNWNNNAGIPGSSEDLSTEFGHH
IHRGYQGEKDRGHREEGEDFSREYGHRVQDHRYPGREVGEENVSEEVFRGHVRQLHGHRE
HDNEDLGDSAENHLPRQRSHSHEDEDGIVSSEYHRHVPRHAHHGHGEEDDDDDGGEEEER
VDVMEDSDDNEHQVHGHQSHSKERDELHHAHSHRHQGHSDDDDDDGVSTEHGHQAHRYQD
HEEEDDGDSDEDSHTHRVQGREDENDDEDGDSGEYRHHTQDHQGHNEEQDDDDDDDDDDE
DKEDSTEHRHQTQGHRKEEDEDESDEDDHHVSRHGRQGYEEEEDDDDDDGDDDSTEHVHQ
AHRHRDHEHKDDEDDSEEDYHHVPSHGRQSHQNEEEEDEAVSTEHWHQSPRHAHHDLGRE
SEEEVAVKYSHHVASHRPQGHNADREEDSLEEHMNEVPGHHHHRASRGDDEDISTEFGHK
APSHRLQDQDERARQGHREPVQGEIAHQPLQPTGPSSRESRKEGDHSSQEGDEDPEQRQA
HSEEEKEEEEEEEEEEEEEKEGGHSLPMSQEDDEEEEKDEKESKVDRAAVSAPLSHHRKQ
GEEEEEEEEEEEEEILEENLLPFTIIPNPLAGREVAREGSSEEESREVTGQQDAQEYENY
QPGSLCGYCSFCNRCTECESCHCDEENMGEHCDQCQHCQFCYLCPLVCDTLCTPGSYVDY
FSSSLYQALADMLETPEP
NT seq 2217 nt   +upstreamnt  +downstreamnt
atgggcttccaggggccatggttgcacacttgtctcctttgggccacagtggccatcctg
ctggtccctccagtggtgacccaggagttgagaggggccggtctgggcctgggcaactgg
aacaacaatgcaggcatccctgggtcctcagaggacctatcaactgagtttggtcaccac
atccaccggggatatcaaggtgagaaggacagaggccacagagaagagggtgaagacttc
tccagggaatatggccacagggtccaagaccacaggtaccctggccgcgaggttggagag
gagaatgtctctgaagaggtcttcagagggcatgttagacagctccacgggcaccgggaa
catgacaatgaagatttaggagactcggcagagaaccacctccccagacagaggagccac
agccacgaagatgaggatggcattgtctccagtgagtatcaccgtcacgtccccaggcat
gcccaccatggccacggagaggaagatgatgacgatgatggaggagaggaggaggagagg
gtggatgtgatggaggactctgatgataatgaacaccaggtccatggtcaccagagccac
tcaaaggagagagatgaactccatcatgcccacagccacaggcaccaaggccacagtgat
gatgacgatgacgatggtgtctctactgagcatggacaccaagctcacagatatcaggat
catgaggaggaagacgatggggactcagatgaagacagtcacacccacagagttcaaggc
cgagaagatgaaaatgatgatgaagacggtgactctggtgaatacagacaccatacccag
gaccaccaaggccacaacgaagagcaagatgacgatgatgatgatgatgatgatgatgaa
gataaagaagactccactgagcaccggcaccagacccaaggccacaggaaggaagaagat
gaggatgagtcagatgaagatgatcatcatgtctccaggcatggacgccaaggctatgaa
gaagaagaagatgatgatgatgatgatggagatgatgactctactgagcatgtgcatcaa
gcccacagacacagagaccatgagcacaaagatgatgaggatgactcagaagaagactac
catcatgtccccagccatggccgccaaagccaccaaaatgaggaagaggaagatgaggct
gtatccactgaacactggcaccagtctcctagacatgctcaccatgatcttggacgtgag
agtgaagaagaggtagcagtcaagtacagccaccatgttgcaagccaccgtccccaaggc
cacaatgctgacagggaggaggactctctagaagaacacatgaatgaagtcccaggccat
caccaccacagagcctccaggggtgatgatgaggacatttctactgagtttggccacaag
gcccccagccacaggctacaagatcaagatgaaagggcgaggcagggtcacagagagcct
gttcagggagagattgctcatcagcccctgcaacccacaggacccagttcaagagaatca
aggaaggaaggtgaccacagctctcaagagggagatgaagacccagagcagaggcaagcc
catagtgaggaggagaaggaggaggaggaggaggaggaggaggaggaggaggaggagaaa
gaggggggccatagcctccccatgagccaggaagatgatgaagaggaagaaaaagatgag
aaagaaagcaaggtagacagggctgcagtttcagctccactgagccatcataggaagcag
ggggaggaagaggaggaggaagaggaggaggaagaggaggagatcctggaggaaaaccta
ctacctttcaccattatcccaaacccactcgctgggagagaggtggccagagaaggttcc
agtgaagaggagagccgtgaggtcacaggtcagcaggatgcccaggagtacgaaaattac
cagccagggtctttgtgtggctactgttctttctgcaaccgatgtaccgaatgtgaaagc
tgtcactgtgatgaggagaacatgggggaacactgtgaccagtgtcagcactgtcaattc
tgctacctctgtccgctggtgtgtgacacgctctgcactccaggaagctacgttgactat
ttctcctcctctctgtatcaagccctggctgacatgttggagactccagagccctga

DBGET integrated database retrieval system