KEGG   Mus musculus (mouse): 16408
Entry
16408             CDS       T01002                                 

Gene name
Itgal, (p180), Cd11, Cd11a, LFA, LFA-1, LFA-1A, Ly-1, Ly-15, Ly-2, Ly-21
Definition
(RefSeq) integrin alpha L
  KO
K05718  integrin alpha L
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04015  Rap1 signaling pathway
mmu04514  Cell adhesion molecules
mmu04613  Neutrophil extracellular trap formation
mmu04650  Natural killer cell mediated cytotoxicity
mmu04670  Leukocyte transendothelial migration
mmu04810  Regulation of actin cytoskeleton
mmu05144  Malaria
mmu05150  Staphylococcus aureus infection
mmu05166  Human T-cell leukemia virus 1 infection
mmu05169  Epstein-Barr virus infection
mmu05323  Rheumatoid arthritis
mmu05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    16408 (Itgal)
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    16408 (Itgal)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    16408 (Itgal)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    16408 (Itgal)
   04650 Natural killer cell mediated cytotoxicity
    16408 (Itgal)
   04670 Leukocyte transendothelial migration
    16408 (Itgal)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    16408 (Itgal)
   05169 Epstein-Barr virus infection
    16408 (Itgal)
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    16408 (Itgal)
  09174 Infectious disease: parasitic
   05144 Malaria
    16408 (Itgal)
  09163 Immune disease
   05323 Rheumatoid arthritis
    16408 (Itgal)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    16408 (Itgal)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    16408 (Itgal)
   04515 Cell adhesion molecules [BR:mmu04515]
    16408 (Itgal)
   04090 CD molecules [BR:mmu04090]
    16408 (Itgal)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   16408 (Itgal)
Cell adhesion molecules [BR:mmu04515]
 Integrins
  Integrin alpha subunits
   16408 (Itgal)
CD molecules [BR:mmu04090]
 Proteins
  16408 (Itgal)
SSDB
Motif
Pfam: Integrin_alpha2 VWA FG-GAP VWA_2 VCBS Integrin_alpha FG-GAP_2
Other DBs
NCBI-GeneID: 16408
NCBI-ProteinID: NP_001240801
MGI: 96606
Ensembl: ENSMUSG00000030830
Vega: OTTMUSG00000031314
UniProt: E9Q5M7
Position
7 F3; 7 69.44 cM
AA seq 1162 aa
MSFRIAGPRLLLLGLQLFAKAWSYNLDTRPTQSFLAQAGRHFGYQVLQIEDGVVVGAPGE
GDNTGGLYHCRTSSEFCQPVSLHGSNHTSKYLGMTLATDAAKGSLLACDPGLSRTCDQNT
YLSGLCYLFPQSLEGPMLQNRPAYQECMKGKVDLVFLFDGSQSLDRKDFEKILEFMKDVM
RKLSNTSYQFAAVQFSTDCRTEFTFLDYVKQNKNPDVLLGSVQPMFLLTNTFRAINYVVA
HVFKEESGARPDATKVLVIITDGEASDKGNISAAHDITRYIIGIGKHFVSVQKQKTLHIF
ASEPVEEFVKILDTFEKLKDLFTDLQRRIYAIEGTNRQDLTSFNMELSSSGISADLSKGH
AVVGAVGAKDWAGGFLDLREDLQGATFVGQEPLTSDVRGGYLGYTVAWMTSRSSRPLLAA
GAPRYQHVGQVLLFQAPEAGGRWNQTQKIEGTQIGSYFGGELCSVDLDQDGEAELLLIGA
PLFFGEQRGGRVFTYQRRQSLFEMVSELQGDPGYPLGRFGAAITALTDINGDRLTDVAVG
APLEEQGAVYIFNGKPGGLSPQPSQRIQGAQVFPGIRWFGRSIHGVKDLGGDRLADVVVG
AEGRVVVLSSRPVVDVVTELSFSPEEIPVHEVECSYSAREEQKHGVKLKACFRIKPLTPQ
FQGRLLANLSYTLQLDGHRMRSRGLFPDGSHELSGNTSITPDKSCLDFHFHFPICIQDLI
SPINVSLNFSLLEEEGTPRDQKVGRAMQPILRPSIHTVTKEIPFEKNCGEDKKCEANLTL
SSPARSGPLRLMSSASLAVEWTLSNSGEDAYWVRLDLDFPRGLSFRKVEMLQPHSRMPVS
CEELTEGSSLLTKTLKCNVSSPIFKAGQEVSLQVMFNTLLNSSWEDFVELNGTVHCENEN
SSLQEDNSAATHIPVLYPVNILTKEQENSTLYISFTPKGPKTQQVQHVYQVRIQPSAYDH
NMPTLEALVGVPWPHSEDPITYTWSVQTDPLVTCHSEDLKRPSSEAEQPCLPGVQFRCPI
VFRREILIQVTGTVELSKEIKASSTLSLCSSLSVSFNSSKHFHLYGSKASEAQVLVKVDL
IHEKEMLHVYVLSGIGGLVLLFLIFLALYKVGFFKRNLKEKMEADGGVPNGSPPEDTDPL
AVPGEETKDMGCLEPLRESDKD
NT seq 3489 nt   +upstreamnt  +downstreamnt
atgagtttccggattgcgggccccagacttttgctactgggactccagctgtttgccaag
gcctggagctacaacctggacacacggcctacgcagagcttcttggcacaagctggaaga
cattttgggtaccaggtcttgcagattgaagatggggttgtcgtgggagccccaggtgag
ggggacaacacgggaggcctctatcactgccgaacaagcagcgagttctgccagccagtc
agcctacatggttctaaccatacctccaagtacttgggaatgacgctggcaacagatgcc
gccaagggaagccttttggcctgtgaccctggactgtctcggacatgcgatcagaacact
tacctcagtggcctctgctacctcttcccccagagtctggagggacctatgttacaaaat
cgtcccgcctatcaggaatgtatgaagggcaaagtcgacctggtgtttctgttcgatggc
tcacagagcttggatagaaaggactttgaaaaaatcctggaattcatgaaggatgtgatg
aggaagctcagcaatacttcctaccagtttgctgccgtccagttctccacagactgcaga
acagaatttactttcttggactacgttaagcagaacaagaaccccgatgttctgctaggc
agcgtgcagcccatgttcttgctgaccaatacctttcgtgccatcaactatgtggtggca
cacgtgttcaaagaagagtctggtgccaggccggatgctaccaaggtgcttgtcatcatt
acagacggggaggcaagtgataaaggcaacatcagtgcggcccacgacataacccgctac
atcatcgggattggcaagcattttgtgagcgtacaaaagcaaaagacgctccacatattt
gcctcagaacctgtagaggaatttgtgaagattctggacacctttgagaagctgaaggat
ctttttactgacctgcagaggaggatttatgctattgagggcacaaacagacaggacctg
acatcctttaacatggaactctcctccagcgggatcagcgcagacctcagcaagggccat
gcagttgtgggagctgttggggctaaggattgggccgggggctttctggacctgcgtgaa
gacctgcagggtgccacatttgttgggcaggaaccgctgacctcagatgtgagagggggc
tacctgggttacactgtggcctggatgacctcccggagctccagacccctgctggcagca
ggagccccacggtaccagcatgtgggacaagtactgcttttccaagccccagaggctgga
ggacgttggaaccaaacccagaagatagaagggactcagatcggatcttactttggtggg
gaactatgtagtgttgacctggaccaagatggcgaggcagagctgctgctgattggagca
cccctgttctttggggagcagagaggaggccgagtgttcacttaccagagaagacagtcg
ctgtttgaaatggtctcagagctacagggtgaccctggctacccgcttggtcggtttgga
gccgccataactgccctgacggacatcaatggggataggctgactgatgtggctgtggga
gcccctttggaggagcagggggctgtgtacatcttcaatgggaagcctggtgggctcagt
ccccagccaagccagcgtatacaaggagcccaggtgttcccaggaatccggtggtttggc
cgctccatccatggggtgaaggaccttggaggggacaggctggcagatgtggttgtagga
gctgagggtcgggtggttgtgctgagctccaggccggtggtggatgtggtcactgagctg
tcgttctccccagaggaaatcccagtgcacgaggtggagtgctcctactcagccagggag
gagcagaaacacggagtcaagctcaaggcatgcttccggatcaagcccctcacgccacag
tttcaaggtcgcctgcttgccaacctcagctacaccctgcagctggatggccatcggatg
aggagccgagggttgttcccagatggaagccacgagctcagtggaaacacctccatcacc
ccagataaatcctgcttggacttccacttccacttcccgatctgcattcaagacctcatc
tcccctatcaatgtctccctgaatttctctcttttggaggaagaaggaacaccaagggac
caaaaggtgggcagggccatgcagcctatcctgagaccttcaatccacacagtgactaag
gagatcccttttgagaagaactgtggtgaagataagaagtgtgaggcaaacctgaccctg
tcatcccctgccagatctggacccctgcgtctgatgtcctctgccagccttgctgtggag
tggacactgagcaactcaggggaagatgcctactgggtgcgattagacctggacttccct
cggggactctccttccggaaagtggagatgcttcagccacacagccgaatgcctgtgagc
tgcgaggagctcaccgaggggtcaagtctcctgactaagacactgaaatgcaatgtaagc
tctcccatcttcaaagcaggccaggaggtgagcctccaggtgatgtttaacacgctactc
aacagctcctgggaagacttcgttgagctgaatggcactgtgcactgtgagaatgagaac
tcaagcctccaggaggacaactcagccgccacccacattcctgtcctgtaccctgtcaac
atccttactaaggagcaggagaactccactctctatatcagtttcacccctaaaggtccc
aagacccaacaagtccagcatgtctaccaggtgaggattcagccatctgcctatgaccac
aacatgcccacactagaggccttggttggggtgccctggcctcacagtgaggaccccatc
acatacacatggagtgtacagacggatccccttgtcacttgccacagcgaggacctgaag
aggccgtccagcgaagctgagcagccttgtctgcctggagtccagttccgctgtccaatt
gtcttcaggcgggagatcctcatccaagtgacggggaccgtggaactctccaaggaaatc
aaggcctcctccacactcagcctctgcagctcactctccgtctccttcaacagcagcaag
catttccatttgtatggcagcaaagcctccgaggcccaggtcctcgtgaaggttgacctg
atccacgagaaggagatgcttcacgtgtacgtactcagcggcattgggggcctcgtgctt
ctgttcctgattttcctggcgctctacaaggttggcttcttcaaacggaacctgaaggag
aagatggaggctgatggaggtgttccaaatggaagccctccagaagacactgaccctctg
gcagtacctggggaagagaccaaagatatgggctgtctagagcccctccgggagagtgac
aaggactaa

KEGG   Mus musculus (mouse): 16414
Entry
16414             CDS       T01002                                 

Gene name
Itgb2, 2E6, AI528527, Cd18, LAD, LCAMB, Lfa1, MF17
Definition
(RefSeq) integrin beta 2
  KO
K06464  integrin beta 2
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04015  Rap1 signaling pathway
mmu04145  Phagosome
mmu04390  Hippo signaling pathway
mmu04514  Cell adhesion molecules
mmu04610  Complement and coagulation cascades
mmu04613  Neutrophil extracellular trap formation
mmu04650  Natural killer cell mediated cytotoxicity
mmu04670  Leukocyte transendothelial migration
mmu04810  Regulation of actin cytoskeleton
mmu05133  Pertussis
mmu05134  Legionellosis
mmu05140  Leishmaniasis
mmu05144  Malaria
mmu05146  Amoebiasis
mmu05150  Staphylococcus aureus infection
mmu05152  Tuberculosis
mmu05166  Human T-cell leukemia virus 1 infection
mmu05323  Rheumatoid arthritis
mmu05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    16414 (Itgb2)
   04390 Hippo signaling pathway
    16414 (Itgb2)
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    16414 (Itgb2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    16414 (Itgb2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    16414 (Itgb2)
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    16414 (Itgb2)
   04613 Neutrophil extracellular trap formation
    16414 (Itgb2)
   04650 Natural killer cell mediated cytotoxicity
    16414 (Itgb2)
   04670 Leukocyte transendothelial migration
    16414 (Itgb2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    16414 (Itgb2)
  09171 Infectious disease: bacterial
   05133 Pertussis
    16414 (Itgb2)
   05134 Legionellosis
    16414 (Itgb2)
   05150 Staphylococcus aureus infection
    16414 (Itgb2)
   05152 Tuberculosis
    16414 (Itgb2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    16414 (Itgb2)
   05144 Malaria
    16414 (Itgb2)
   05140 Leishmaniasis
    16414 (Itgb2)
  09163 Immune disease
   05323 Rheumatoid arthritis
    16414 (Itgb2)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    16414 (Itgb2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    16414 (Itgb2)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    16414 (Itgb2)
   04515 Cell adhesion molecules [BR:mmu04515]
    16414 (Itgb2)
   04090 CD molecules [BR:mmu04090]
    16414 (Itgb2)
Membrane trafficking [BR:mmu04131]
 Endocytosis
  Phagocytosis
   Integrins (complement receptors)
    16414 (Itgb2)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   16414 (Itgb2)
Cell adhesion molecules [BR:mmu04515]
 Integrins
  Integrin beta subunits
   16414 (Itgb2)
CD molecules [BR:mmu04090]
 Proteins
  16414 (Itgb2)
SSDB
Motif
Pfam: Integrin_beta Integrin_b_cyt Integrin_B_tail PSI_integrin EGF_2
Other DBs
NCBI-GeneID: 16414
NCBI-ProteinID: NP_032430
MGI: 96611
Ensembl: ENSMUSG00000000290
Vega: OTTMUSG00000019985
UniProt: P11835 Q542I8
Position
10 C1; 10 39.72 cM
AA seq 770 aa
MLGPHSLLLALAGLFFLGSAVSQECTKYKVSSCRDCIQSGPGCSWCQKLNFTGPGEPDSL
RCDTRAQLLLKGCPADDIMDPRSIANPEFDQRGQRKQLSPQKVTLYLRPGQAAAFNVTFR
RAKGYPIDLYYLMDLSYSMLDDLNNVKKLGGDLLQALNEITESGRIGFGSFVDKTVLPFV
NTHPEKLRNPCPNKEKACQPPFAFRHVLKLTDNSNQFQTEVGKQLISGNLDAPEGGLDAI
MQVAACPEEIGWRNVTRLLVFATDDGFHFAGDGKLGAILTPNDGRCHLEDNMYKRSNEFD
YPSVGQLAHKLSESNIQPIFAVTKKMVKTYEKLTEIIPKSAVGELSDDSSNVVQLIKNAY
YKLSSRVFLDHSTLPDTLKVTYDSFCSNGASSIGKSRGDCDGVQINNPVTFQVKVMASEC
IQEQSFVIRALGFTDTVTVQVRPQCECQCRDQSREQSLCGGKGVMECGICRCESGYIGKN
CECQTQGRSSQELERNCRKDNSSIVCSGLGDCICGQCVCHTSDVPNKEIFGQYCECDNVN
CERYNSQVCGGSDRGSCNCGKCSCKPGYEGSACQCQRSTTGCLNARLVECSGRGHCQCNR
CICDEGYQPPMCEDCPSCGSHCRDNHTSCAECLKFDKGPFEKNCSVQCAGMTLQTIPLKK
KPCKERDSEGCWITYTLQQKDGRNIYNIHVEDSLECVKGPNVAAIVGGTVVGVVLIGVLL
LVIWKALTHLTDLREYRRFEKEKLKSQWNNDNPLFKSATTTVMNPKFAES
NT seq 2313 nt   +upstreamnt  +downstreamnt
atgctgggcccacactcactgctgcttgccctagctggactgttcttcctgggatctgct
gtgtcccaggaatgcaccaagtacaaagtcagcagttgccgggactgtatccagtcgggg
cctggctgttcctggtgccagaagctgaacttcactggaccaggagaacctgactccttg
cgctgtgacacacgggcacagctgctgctgaagggttgtccagccgatgatatcatggac
cccaggagcatcgctaatcctgagttcgaccaacgggggcaacggaaacagctatctcca
caaaaagtgacactttacttgcgaccaggacaggctgccgcattcaatgtgactttccgg
cgggccaagggataccccattgatctgtactacctcatggatctctcctactccatgctt
gatgacctcaacaacgtcaagaagctgggcggggacttgctgcaggccctcaacgagatc
accgagtctggccgcatcggctttgggtcgtttgtggacaagacggtgctgccttttgtt
aacacccatcctgagaagctgaggaacccatgtcccaacaaggagaaggcctgccagccc
ccatttgcctttcggcacgtgctcaagttaaccgacaactccaaccagtttcagacagag
gtcggcaagcaactgatttccggaaacctggacgcccctgagggtgggctggatgccata
atgcaagttgctgcatgtccggaggaaattggctggcgcaatgtcacgaggctgctggtg
tttgccacagacgatggcttccactttgctggtgatggcaaactgggtgccatcctgacc
cccaatgatggccgctgccacctggaggataacatgtacaagaggagcaatgagttcgac
tacccatccgtgggtcagctggcacacaaactttccgagagcaacatccagcccatcttt
gcggtgacaaagaagatggtgaaaacgtatgagaaactcacggagatcatccccaagtca
gcagtgggggaactgtctgacgactccagcaacgtggtgcagctcatcaagaatgcctac
tataaactctcctctagagtcttcctggaccacagcaccctcccggacaccctgaaagtc
acctatgactccttctgcagtaatggagcatcgagtataggcaaatcccgtggggactgt
gatggcgtacagatcaacaacccggtcaccttccaggtaaaggtcatggcttccgagtgt
atccaggagcagtcctttgtcatccgggcactgggtttcacggatacagtgaccgtgcag
gtccgtccccagtgtgagtgtcagtgccgggaccagagtcgggagcagagtctctgtgga
ggcaagggagtcatggagtgtggtatctgcaggtgtgagtctggctacattgggaaaaac
tgtgagtgccagactcagggtcggagcagccaggagctggagagaaactgtcggaaggac
aatagttccatcgtgtgctcagggcttggggactgcatctgtgggcagtgtgtatgccat
accagtgacgtccccaacaaagagatctttgggcaatactgcgagtgtgacaatgtcaac
tgtgagagatataacagccaagtctgcggtggctcagatcggggttcctgcaactgtggc
aaatgtagttgcaagcccggttacgagggctcggcctgccagtgtcagaggtccaccacg
ggctgtctgaatgcacggctggtagagtgcagtggccgtggccactgccaatgcaacagg
tgcatatgtgacgaaggctaccagccaccgatgtgtgaggattgtcccagctgtggctcg
cactgcagggacaaccacacctcttgtgccgagtgcctgaagtttgataagggccctttt
gagaagaactgtagtgttcagtgtgctggtatgacgctgcagactatccctttgaagaaa
aagccctgcaaggagagggactcggaaggctgttggataacttacactttgcagcagaag
gacggaaggaacatttacaacatccatgtggaggacagtctagagtgtgtgaagggcccc
aatgtggctgccatcgtagggggcaccgtggtaggtgtcgtactgattggtgtcctcctc
ctggtcatctggaaggccctgacccacctgactgacctcagggagtacaggcgctttgag
aaggagaaactcaagtcccaatggaacaatgacaaccccctcttcaagagtgctacgaca
acggtcatgaaccccaagtttgctgaaagctag

KEGG   Mus musculus (mouse): 16415
Entry
16415             CDS       T01002                                 

Gene name
Itgb2l, 5033406G21Rik, pac, pactolus
Definition
(RefSeq) integrin beta 2-like
  KO
K06464  integrin beta 2
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04015  Rap1 signaling pathway
mmu04145  Phagosome
mmu04390  Hippo signaling pathway
mmu04514  Cell adhesion molecules
mmu04610  Complement and coagulation cascades
mmu04613  Neutrophil extracellular trap formation
mmu04650  Natural killer cell mediated cytotoxicity
mmu04670  Leukocyte transendothelial migration
mmu04810  Regulation of actin cytoskeleton
mmu05133  Pertussis
mmu05134  Legionellosis
mmu05140  Leishmaniasis
mmu05144  Malaria
mmu05146  Amoebiasis
mmu05150  Staphylococcus aureus infection
mmu05152  Tuberculosis
mmu05166  Human T-cell leukemia virus 1 infection
mmu05323  Rheumatoid arthritis
mmu05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    16415 (Itgb2l)
   04390 Hippo signaling pathway
    16415 (Itgb2l)
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    16415 (Itgb2l)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    16415 (Itgb2l)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    16415 (Itgb2l)
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    16415 (Itgb2l)
   04613 Neutrophil extracellular trap formation
    16415 (Itgb2l)
   04650 Natural killer cell mediated cytotoxicity
    16415 (Itgb2l)
   04670 Leukocyte transendothelial migration
    16415 (Itgb2l)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    16415 (Itgb2l)
  09171 Infectious disease: bacterial
   05133 Pertussis
    16415 (Itgb2l)
   05134 Legionellosis
    16415 (Itgb2l)
   05150 Staphylococcus aureus infection
    16415 (Itgb2l)
   05152 Tuberculosis
    16415 (Itgb2l)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    16415 (Itgb2l)
   05144 Malaria
    16415 (Itgb2l)
   05140 Leishmaniasis
    16415 (Itgb2l)
  09163 Immune disease
   05323 Rheumatoid arthritis
    16415 (Itgb2l)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    16415 (Itgb2l)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    16415 (Itgb2l)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    16415 (Itgb2l)
   04515 Cell adhesion molecules [BR:mmu04515]
    16415 (Itgb2l)
   04090 CD molecules [BR:mmu04090]
    16415 (Itgb2l)
Membrane trafficking [BR:mmu04131]
 Endocytosis
  Phagocytosis
   Integrins (complement receptors)
    16415 (Itgb2l)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   16415 (Itgb2l)
Cell adhesion molecules [BR:mmu04515]
 Integrins
  Integrin beta subunits
   16415 (Itgb2l)
CD molecules [BR:mmu04090]
 Proteins
  16415 (Itgb2l)
SSDB
Motif
Pfam: Integrin_beta PSI_integrin EGF_2 I-EGF_1 Tmemb_9
Other DBs
NCBI-GeneID: 16415
NCBI-ProteinID: NP_032431
MGI: 1277979
Ensembl: ENSMUSG00000000157
Vega: OTTMUSG00000020391
UniProt: Q3UV74
Structure
PDB: 
2IUE

Position
16; 16 C4
AA seq 738 aa
MLGQCTLLPVLAGLLSLESALSQLCTKDNVSTCQDCIRSGPSCAWCQKLNFTGRGEPDSV
RCDTPEQLLLKGCTSEYLVDPKSLAESQEDKERDQRQLSPRNVTVFLRPGQAATFKVDFQ
RTQDNSVDLYFLMGLSGSAQGHLSNVQTLGSDLLKALNEISRSGRIGFGSIVNMTFQHIL
KLTADSSQFQRELRKQLVSGKLATPKGQLDAVVQVAICLGEIGWRNGTRFLVLVTDNDFH
LAKDKTLGTRQNTSDGRCHLDDGMYRSRGEPDYQSVVQLASKLAENNIQPIFVVPSRMVK
TYEKLTTFIPKLTIGELSDDSSNVAQLIRNAYSKLSSIVVLNHSTIPSILKVTYDSYCSN
GTSNPGKPSGDCSGVQINDQVTFQVNITASECFREQFFFIQALGFMDSVTVRVLPLCECQ
CQEQSQHHSLCGGKGAMECGICRCNSGYAGKNCECQTQGPSSQDLEGSCRKDNSSIMCSG
LGDCICGQCECHTSDIPNKEIYGQYCECNNVNCERYDGQVCGGPERGHCSCGRCFCRYGF
VGSACQCRMSTSGCLNNRMVECSGHGRCYCNRCLCDPGYQPPLCEKRPGYFHRCSEYYSC
ARCLKDNSAIKCRECWNLLFSNTPFSNKTCMTERDSEGCWTTYTLYQPDQSDINSIYIKE
SLVCAEISNTTILLGVIVGVLLAVIFLLVYCMVYLKGTQKAAKLPRKGGAQSTLAQQPHF
QEPHHVEPVWNQERQGTQ
NT seq 2217 nt   +upstreamnt  +downstreamnt
atgctgggccagtgcactctgctacctgtcctagctgggctgctgtctctggaatctgca
ctgtctcagttgtgtaccaaggacaatgtgagcacctgtcaggactgtatccggtcaggg
cccagctgtgcctggtgccagaagctgaacttcacagggcgaggggagcccgactcagtt
cgctgtgatacaccagagcaactgttgctaaaaggctgcacatctgagtacctcgtggac
cccaagagtcttgctgaatcccaggaagacaaggagagggaccagaggcagctgtctcca
cgaaatgtgacagttttcttaagaccgggtcaagcggcaacattcaaagtggacttccag
cggacccaggacaactctgttgacctgtacttcctgatgggcctctctggctctgcgcaa
ggccacctctccaatgtccagacactgggcagtgacctgctcaaagccctcaatgagatc
tccaggtcaggccgaatcggctttggatccattgtgaacatgaccttccagcacatcctg
aagctgactgcggactccagccaatttcagagggagctgaggaagcaactggtttctgga
aagctggctacccccaagggacagctggatgctgtggttcaagttgccatatgcctggga
gaaatcggctggcgcaatgggacccgatttctggtgcttgttactgacaacgatttccac
ttggctaaagacaagactctgggtaccagacagaacaccagcgatggtcgctgtcacctg
gacgacggcatgtacaggagcaggggagaacctgactaccagtcagtggtccagctggca
agcaaactggctgaaaacaacatccagcccatcttcgtggtgccctcaaggatggtgaaa
acctatgagaaacttaccacattcatccccaagctgaccattggggagctgtcagatgac
tccagcaacgtggcacagctcatcaggaacgcctacagtaaactctcctccattgttgtg
ctgaaccacagcaccatccccagcatcctgaaagttacctacgactcctactgcagcaat
ggaacatcaaatccaggcaaacccagcggggactgcagtggtgtacagatcaatgaccag
gtcaccttccaggttaacatcacagcttcagagtgcttccgggagcagttctttttcatc
caggcactgggcttcatggattcagtgaccgtgcgggtccttcccctgtgtgagtgccag
tgccaggagcagagtcaacaccacagcctctgtggaggcaagggagccatggagtgtggc
atctgcaggtgcaactctggctacgctgggaaaaactgtgagtgccagacacagggcccg
agcagccaggatctggagggaagctgccggaaggacaatagttccatcatgtgctcgggg
ctgggagactgtatctgtgggcagtgtgagtgccacaccagtgacatccccaacaaagag
atctatgggcaatactgcgagtgcaacaatgtcaactgtgagagatatgatggccaagtc
tgcggtggcccagaaagaggccactgctcctgtggccgatgcttttgtcgttacggcttc
gtgggctcagcctgccagtgccggatgtccacttcaggctgtctgaacaacaggatggtg
gagtgcagtggccatggtcgatgctactgtaacagatgcctctgtgacccgggctaccag
ccaccactgtgtgagaagcgtcctggctatttccatcgctgctccgagtactactcctgt
gccaggtgcttgaaagacaacagtgcaataaaatgcagagagtgttggaatctgctgttt
tccaacacccccttcagtaacaagacctgcatgactgaacgggactcagagggctgttgg
acaacctacactctatatcagccagaccagagtgacatcaattccatctacataaaggag
agcctagtgtgtgcagaaatctccaataccaccatcctactgggcgttatagtgggcgtc
ttgctggctgttatcttcctgctggtttactgtatggtttacctgaagggaacccagaag
gctgccaagctccccagaaagggtggggctcaaagcacactggcacagcagcctcatttc
caagaaccccaccatgtggagccagtgtggaatcaagagagacagggtacccaatga

DBGET integrated database retrieval system