KEGG   Mus musculus (mouse): 16640
Entry
16640             CDS       T01002                                 

Gene name
Klra9, LY49, LY49I1, Ly4, Ly49I
Definition
(RefSeq) killer cell lectin-like receptor subfamily A, member 9
  KO
K24240  killer cell lectin-like receptor subfamily A member 9
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04650  Natural killer cell mediated cytotoxicity
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    16640 (Klra9)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04091 Lectins [BR:mmu04091]
    16640 (Klra9)
Lectins [BR:mmu04091]
 C-Type lectins
  Gropu 5: NK-cell receptors
   16640 (Klra9)
SSDB
Motif
Pfam: Ly49 Lectin_C MFS_Mycoplasma Tetraspanin
Other DBs
NCBI-GeneID: 16640
NCBI-ProteinID: NP_034781
MGI: 1321153
Ensembl: ENSMUSG00000033024
Vega: OTTMUSG00000023020
UniProt: Q64329 Q2TJJ8
Structure
PDB: 
1JA3

Position
6 F3; 6 63.44 cM
AA seq 266 aa
MNEPEVTYSTVRLHKSSGLQKLVRHEETQGPREAGNRKCSVSWQLIVKALGILCFLLLVI
VAVLTIKIFQYSQHKQEINETLNHYHNCSNMQSDFNLKEEMLTNKSIDCRPSNELLDYIK
REQDRWNSETKTVLDSSRDTGRGVKHWFCYGTKCYYFIMNKTTWSGCKANCQHYSVPIVK
IEDEDELKFLQRHVIPESYWIGLSYDKKKKEWAWIDNGQSKLDMKTRKMNFKSRGCVFLS
KARIEDTDCNIPYYCICGKKLDKFPD
NT seq 801 nt   +upstreamnt  +downstreamnt
atgaatgagccggaggtcacttactcaactgtgagacttcataagtcttcagggttgcag
aaattagtaaggcatgaggagactcaagggcccagagaagctggcaacagaaagtgttca
gtatcctggcaactcattgtgaaagctcttggaatcctctgtttccttcttctggtaata
gttgcagtgttgacgataaagatttttcagtatagtcaacacaaacaagaaatcaatgaa
actctcaaccactaccataactgcagcaacatgcaaagtgatttcaacttaaaggaagaa
atgttgacaaataagtctatagattgtaggccaagcaatgaacttctggattacatcaaa
agagaacaggacagatggaacagtgaaaccaagacggttttagattcctcacgggacaca
ggcagaggtgttaaacactggttctgctatggtactaaatgttattatttcatcatgaac
aaaactacatggagtggatgtaaagcgaactgccagcattacagcgttcccattgtgaag
atagaagatgaagatgaactgaaattccttcaacgccatgttattccagagagttactgg
attggattgtcttatgataagaaaaaaaaggaatgggcatggattgacaatggccaatct
aaacttgacatgaaaacaaggaaaatgaactttaagtctagaggatgtgtatttttatct
aaagcaagaatagaagatactgactgtaatattccctactactgtatttgtgggaagaaa
ctggataaattccctgattaa

DBGET integrated database retrieval system