KEGG   Mus musculus (mouse): 16885
Entry
16885             CDS       T01002                                 

Symbol
Limk1, KIZ-1, LIMK-1, Limk
Name
(RefSeq) LIM-domain containing, protein kinase
  KO
K05743  LIM domain kinase 1 [EC:2.7.11.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04360  Axon guidance
mmu04666  Fc gamma R-mediated phagocytosis
mmu04810  Regulation of actin cytoskeleton
mmu05135  Yersinia infection
mmu05170  Human immunodeficiency virus 1 infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    16885 (Limk1)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    16885 (Limk1)
  09158 Development and regeneration
   04360 Axon guidance
    16885 (Limk1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    16885 (Limk1)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    16885 (Limk1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    16885 (Limk1)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     16885 (Limk1)
Protein kinases [BR:mmu01001]
 Serine/threonine kinases: TKL group
  LISK family [OT]
   16885 (Limk1)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase LIM PDZ Kdo PDZ_6 APH Pkinase_fungal RIO1 PDZ_2 PknG_TPR
Other DBs
NCBI-GeneID: 16885
NCBI-ProteinID: NP_034847
MGI: 104572
Ensembl: ENSMUSG00000029674
Vega: OTTMUSG00000026202
UniProt: P53668 Q3UR47
Position
5 74.73 cM; 5 G2
AA seq 647 aa
MRLTLLCCTWREERMGEEGSELPVCASCGQRIYDGQYLQALNADWHADCFRCCECSVSLS
HQYYEKDGQLFCKKDYWARYGESCHGCSEHITKGLVMVAGELKYHPECFICLACGNFIGD
GDTYTLVEHSKLYCGQCYYQTVVTPVIEQILPDSPGSHLPHTVTLVSIPASAHGKRGLSV
SIDPPHGPPGCGTEHSHTVRVQGVDPGCMSPDVKNSIHVGDRILEINGTPIRNVPLDEID
LLIQETSRLLQLTLEHDPHDSLGHGPVSDPSPLSSPVHTPSGQAASSARQKPVLRSCSID
TSPGTSSLASPASQRKDLGRSESLRVVCRPHRIFRPSDLIHGEVLGKGCFGQAIKVTHRE
TGEVMVMKELIRFDEETQRTFLKEVKVMRCLEHPNVLKFIGVLYKDKRLNFITEYIKGGT
LRGIIKNMDSQYPWSQRVSFAKDIASGMAYLHSMNIIHRDLNSHNCLVRENRNVVVADFG
LARLMIDEKNQSEDLRSLKKPDRKKRYTVVGNPYWMAPEMINGRSYDEKVDVFSFGIVLC
EIIGRVNADPDYLPRTMDFGLNVRGFLDRYCPPNCPPSFFPITVRCCDLDPEKRPSFVKL
EQWLETLRMHLSGHLPLGPQLEQLERGFWETYRRGESSLPAHPEVPD
NT seq 1944 nt   +upstreamnt  +downstreamnt
atgaggttgacgctactttgttgcacctggagggaagaacgtatgggagaggaaggaagc
gagttgcctgtgtgtgcgagctgtggccagaggatctatgacggccagtacctccaggcc
ctgaatgctgactggcatgcagactgcttcaggtgctgcgagtgtagcgtctccctttca
caccagtactacgagaaggatggacagctcttctgcaagaaggactactgggcccgctat
ggcgagtcttgccacgggtgctccgagcacatcaccaaagggctggtcatggtggctggg
gagctgaagtaccaccctgagtgtttcatctgcctcgcctgtggaaacttcattggcgat
ggggacacctacacactggtggagcactccaagctgtactgtggccagtgctactaccag
accgtggtaactccagtcatcgaacagatcctacctgactcacccggctcccacctgccc
cacacagtcaccctcgtgtctatcccagcctctgcccatggcaaacgaggcctgtctgtc
tccatcgacccccctcacggcccaccaggatgtggcacggagcattcgcacactgtccga
gtccaaggagtggacccaggctgcatgagcccagatgtgaagaattccatccacgttgga
gaccggatcttggaaatcaatggcacgcccatccggaatgtgccgctggacgagatcgac
ttgctgatccaggagaccagccgcctgctccagctgaccctcgagcacgacccccatgac
tcactgggccatgggcccgtgtcggatcccagccccctgagctccccggtgcacactccc
agcggacaggcagccagctctgcccggcagaaacctgtcttgaggagctgcagtattgac
acgtccccgggtaccagctcactagcctctccagcctcccagcgcaaggacctgggtcgc
tccgaatccctccgagtggtctgccgaccacaccgaatcttccggccatctgatctcatc
catggggaagtgctgggcaagggctgttttggccaggccatcaaggtgacacaccgagaa
acaggcgaggtgatggtgatgaaggaacttatccggtttgatgaggagacccagaggaca
ttcctcaaggaggtaaaggtcatgcgctgcctggagcaccctaacgtgctcaagttcatc
ggagtgctctacaaggacaagcggctaaacttcatcacagagtacatcaagggcggcacc
ctgcggggcatcatcaagaacatggacagccagtacccgtggagtcagagggtcagcttt
gccaaggacattgcatcagggatggcctacctccattcgatgaacatcatccaccgagac
ctcaactcccacaactgtctggtccgtgagaataggaacgtggtggtggccgactttggg
ctggctcgactcatgatcgatgaaaagaatcagtctgaagacttacgcagccttaagaag
ccggaccgcaagaagcggtacacagtggtgggcaacccctactggatggcgccagagatg
atcaatggtcgtagttatgatgaaaaggtggacgtgttttcctttggaattgtcctctgt
gagattatcgggcgtgtgaatgcagaccctgactatctgccccgcactatggactttggc
ctcaatgtaaggggtttcctggaccgctactgtccaccaaactgtcccccaagtttcttc
cccatcactgtgcgctgctgtgacctggatcctgaaaagagaccctcttttgtaaagctg
gaacaatggctagaaacacttcgcatgcacttgtctggtcacctgccactgggcccacaa
ctggaacaactggagcggggcttctgggagacctaccggcggggcgagagctcactgcct
gcccaccccgaggtccctgactga

KEGG   Mus musculus (mouse): 16886
Entry
16886             CDS       T01002                                 

Symbol
Limk2, Lim, Limk, Limk-2, whe
Name
(RefSeq) LIM motif-containing protein kinase 2
  KO
K05744  LIM domain kinase 2 [EC:2.7.11.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04360  Axon guidance
mmu04666  Fc gamma R-mediated phagocytosis
mmu04810  Regulation of actin cytoskeleton
mmu05170  Human immunodeficiency virus 1 infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    16886 (Limk2)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    16886 (Limk2)
  09158 Development and regeneration
   04360 Axon guidance
    16886 (Limk2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    16886 (Limk2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    16886 (Limk2)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     16886 (Limk2)
Protein kinases [BR:mmu01001]
 Serine/threonine kinases: TKL group
  LISK family [OT]
   16886 (Limk2)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase LIM PDZ Kdo PDZ_6 PDZ_2 APH zf-RRN7
Other DBs
NCBI-GeneID: 16886
NCBI-ProteinID: NP_034848
MGI: 1197517
Ensembl: ENSMUSG00000020451
Vega: OTTMUSG00000000764
UniProt: O54785 Q8BS94
Structure
PDB: 
2YUB

Position
11; 11 A1
AA seq 638 aa
MAALAGDEAWRCRGCGTYVPLSQRLYRTANEAWHGSCFRCSECQESLTNWYYEKDGKLYC
HKDYWAKFGEFCHGCSLLMTGPAMVAGEFKYHPECFACMSCKVIIEDGDAYALVQHATLY
CGKCHNEVVLAPMFERLSTESVQDQLPYSVTLISMPATTECRRGFSVTVESASSNYATTV
QVKEVNRMHISPNNRNAIHPGDRILEINGTPVRTLRVEEVEDAIKQTSQTLQLLIEHDPV
PQRLDQLRLDARLPPHMQSTGHTLMLSTLDTKENQEGTLRRRSLRRSNSISKSPGPSSPK
EPLLLSRDISRSESLRCSSSYSQQIFRPCDLIHGEVLGKGFFGQAIKVTHKATGKVMVMK
ELIRCDEETQKTFLTEVKVMRSLDHPNVLKFIGVLYKDKKLNLLTEYIEGGTLKDFLRSV
DPFPWQQKVRFAKGISSGMAYLHSMCIIHRDLNSHNCLIKLDKTVVVADFGLSRLIVEER
KRPPVEKATTKKRTLRKSDRKKRYTVVGNPYWMAPEMLNGKSYDETVDVFSFGIVLCEII
GQVYADPDCLPRTLDFGLNVKLFWEKFVPTDCPPAFFPLAAICCKLEPESRPAFSKLEDS
FEALSLFLGELAIPLPAELEDLDHTVSMEYGLTRDSPP
NT seq 1917 nt   +upstreamnt  +downstreamnt
atggcggcgctggcgggtgatgaagcctggaggtgtcggggctgtggcacctatgttccc
ctgagccagaggctctataggactgccaatgaagcctggcatggctcctgcttccggtgt
tccgaatgccaggaatccctcaccaactggtactatgagaaggatgggaagctgtactgc
cacaaggactactgggccaagtttggagaattctgccatgggtgctccctgctgatgacg
gggccagccatggtggctggggagtttaagtaccacccagagtgctttgcctgcatgagt
tgcaaggtgatcattgaggatggagatgcatatgccctggtgcagcacgctacactctac
tgtgggaagtgccacaacgaggtggtgctggcacccatgtttgaaagactgtctacagag
tctgtccaggatcagctgccctactctgtcacgctcatctccatgcctgctaccaccgag
tgtagacgcggcttctcggtgactgtggaaagtgcctcttctaactatgccaccaccgtt
caagtgaaagaggtcaaccggatgcacatcagtcccaacaaccgaaatgccatccaccct
ggggaccgcatcttggagatcaatgggacccctgtccgtactctgcgagtagaggaggtg
gaggatgcaataaagcagacaagccagacacttcagctgctgattgaacatgaccctgtg
ccccagcgcctggaccagctacggctagatgcccgacttcctccccacatgcagagcacc
ggacacacgctcatgctcagcaccttggacaccaaggagaatcaggaggggacactgagg
agacgttctctgaggcgcagtaacagcatctccaagtctccgggccccagctcccccaag
gagcccctgctcctcagccgggacataagccgctcagaatccctccgctgctctagcagc
tactcccagcagatcttccggccctgcgacctgatccacggggaggtcctggggaagggc
ttctttgggcaggccatcaaggtgactcacaaagccacaggcaaagtgatggtcatgaag
gagttgatccgctgtgatgaggaaacccagaagactttcctgactgaggtgaaagtgatg
cggagcctggaccaccctaatgtgctcaagttcatcggagttctgtacaaggacaagaag
ctgaatctgctgaccgagtacatcgagggaggcacactcaaagacttcctgcgcagtgtg
gacccgttcccctggcaacagaaggtcaggtttgccaaaggcatctcctctggaatggcc
tatttacactccatgtgcatcatccaccgggacctgaactcacacaactgtctcatcaaa
ttggacaagacagtggtagtagccgactttgggctgtcacggcttatagtagaagagagg
aaaaggcctccagtagagaaggccaccaccaagaaacgcaccttacgcaagagtgaccgc
aaaaagcgctacactgtggtgggaaacccctactggatggcccccgagatgctgaatggc
aagagctacgatgagacggtggatgtcttctcttttgggatcgttctctgtgagatcatt
gggcaggtatatgcggatcctgattgcctgccccgcacactggactttggcctcaatgtt
aagcttttctgggagaagtttgtcccaacagactgtcccccagccttcttccccctggct
gctatctgctgcaaactagagcctgaaagcagaccggcattctcaaagctggaggactcg
ttcgaggcgctctccctgttcttgggggagctggccatcccactgccagcagagctggaa
gacctggaccacactgtgagcatggagtatggcctaacccgggactcgccaccctag

DBGET integrated database retrieval system