KEGG   Mus musculus (mouse): 16912
Entry
16912             CDS       T01002                                 

Gene name
Psmb9, Lm, Lmp, Lmp-2, Lmp2
Definition
(RefSeq) proteasome (prosome, macropain) subunit, beta type 9 (large multifunctional peptidase 2)
  KO
K02741  20S proteasome subunit beta 9 [EC:3.4.25.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03050  Proteasome
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    16912 (Psmb9)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mmu01002]
    16912 (Psmb9)
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:mmu03051]
    16912 (Psmb9)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.25  Threonine endopeptidases
    3.4.25.1  proteasome endopeptidase complex
     16912 (Psmb9)
Peptidases and inhibitors [BR:mmu01002]
 Threonine peptidases
  Family T1: proteasome family
   16912 (Psmb9)
Proteasome [BR:mmu03051]
 Eukaryotic proteasome
  Core particles (20S proteasome)
   beta type subunits
    16912 (Psmb9)
SSDB
Motif
Pfam: Proteasome
Other DBs
NCBI-GeneID: 16912
NCBI-ProteinID: NP_038613
MGI: 1346526
Ensembl: ENSMUSG00000096727
Vega: OTTMUSG00000036472
UniProt: P28076 A0A0R4J256
Structure
PDB: 
3UNF 3UNH

Position
17 B1; 17 17.98 cM
AA seq 219 aa
MLRAGAPTAGSFRTEEVHTGTTIMAVEFDGGVVVGSDSRVSAGTAVVNRVFDKLSPLHQH
IFCALSGSAADAQAIADMAAYQLELHGLELEEPPLVLAAANVVKNISYKYREDLLAHLIV
AGWDQCEGGQVYGTMGGMLIRQPFTIGGSGSSYIYGYVDAAYKPGMTPEECRRFTTDAIT
LAMNRDGSSGGVIYLVTITAAGVDHRVILGDELPKFYDE
NT seq 660 nt   +upstreamnt  +downstreamnt
atgctgcgggcaggagcacctaccgccggctcgttccggacggaagaagtccacaccggg
acaaccatcatggcagtggagtttgacgggggtgtcgtggtgggctctgattcccgggtg
tcagcgggaacagcagtggtgaaccgcgtgttcgacaagctctcccctctgcaccagcac
atcttctgtgccctctcaggttccgctgctgatgcccaagccatagctgacatggccgcc
taccagctggagctacacgggttggagctggaggagccgcccctcgttctggctgctgca
aacgtggtgaagaacatctcctacaagtaccgtgaggacttgttagcgcatctcatagta
gctggctgggaccaatgtgaggggggacaggtatatggaaccatgggagggatgctaatt
cgacagccctttaccatcggcggttccggaagctcctacatttatggttatgtggacgca
gcttataagccaggcatgacccctgaggagtgccggcgtttcaccacagatgccatcact
ctggccatgaaccgagatggctctagtgggggtgtcatctacctggtcaccatcacagct
gctggtgtggaccatcgagtcatcctgggagatgagctgccaaaattctacgatgagtga

DBGET integrated database retrieval system