KEGG   Mus musculus (mouse): 17220
Entry
17220             CDS       T01002                                 

Gene name
Mcm7, AI747533, Mcmd7, mCDC47
Definition
(RefSeq) minichromosome maintenance complex component 7
  KO
K02210  DNA replication licensing factor MCM7 [EC:3.6.4.12]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03030  DNA replication
mmu04110  Cell cycle
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    17220 (Mcm7)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    17220 (Mcm7)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mmu01009]
    17220 (Mcm7)
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:mmu03032]
    17220 (Mcm7)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     17220 (Mcm7)
Protein phosphatases and associated proteins [BR:mmu01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     17220 (Mcm7)
DNA replication proteins [BR:mmu03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   pre-RC (pre-replication complex)
    17220 (Mcm7)
SSDB
Motif
Pfam: MCM MCM_OB MCM_lid MCM_N Mg_chelatase AAA_5 AAA_3 MCM_bind Sigma54_activat AAA_lid_2 Mg_chelatase_C
Other DBs
NCBI-GeneID: 17220
NCBI-ProteinID: NP_032594
MGI: 1298398
Ensembl: ENSMUSG00000029730
Vega: OTTMUSG00000022672
UniProt: Q61881 Q3U4T8
Position
5; 5 G2
AA seq 719 aa
MALKDYAIEKEKVKKFLQEFYYENELGKKQFKYGTQLVHLAHREQVALYVDLDDIAEDDP
ELVDSICENAKRYSRLFGDVVQELLPEYKEKEVVNKDVLDVYIEHRLMMEQRSRDPGAVR
NPQNQYPSELMRRFELYFRGPSSSKPRVIREVRADSVGKLLTVRGIVTRVSEVKPRMVVA
TYTCDQCGAETYQPIQSPTFMPLIMCPSQECQTNRSGGRLYLQTRGSKFVKFQEMKIQEH
SDQVPVGNIPRSITVVLEGENTRIAQPGDHVSVTGIFLPVLRTGFQQMAQGLLSETYLEA
HWIVKMTKSDDDVSGAGELSSEELKQIAEEDFYEKLAASIAPEIYGHEDVKKALLLLLVG
GVDQSPQGMKIRGNIHICLMGDPGVAKSQLLSYIDRLAPRSQYTTGRGSSGVGLTAAVLR
DSVSGELTLEGGALVLADQGVCCIDEFDKMAEADRTAIHEVMEQQTISIAKAGILTTLNA
RCSILAAANPAYGRYNPRRSLEQNVQLPAALLSRFDLLWLIQDRPDRDNDLRLAQHITYV
HQHSRQPPAQFEPLDMKLMRRYIAMCHERQPTVPESLADYITAAYVEMRREARASKDATY
TSARTLLAILRLSTALARLRMVDIVEKEDVNEAIRLMEMSKDSLLGEKGQTARTQRPADV
IFATIRELVSRGRSVHFSEAEQRCISRGFTPAQFQAALDEYEELNVWQVNTSRTRITFV
NT seq 2160 nt   +upstreamnt  +downstreamnt
atggcgcttaaggactacgcgatcgaaaaagaaaaagttaagaagttcctccaagagttt
tattacgagaatgagcttggaaagaagcagttcaagtatgggacccagttggttcatctg
gctcatcgggaacaagtggcactgtatgtggacctggatgacatagctgaagatgaccct
gagttggtcgactcaatttgcgagaatgccaagcgctactcaagactgtttggtgatgtt
gtgcaagagcttttgcctgagtacaaggagaaggaggtggtgaataaggatgtcttagat
gtttacattgaacaccggctgatgatggagcagcgaagcagagaccctggggcagtccgg
aacccccaaaaccagtatccttctgaactcatgcgaagatttgagttgtatttccgaggc
ccaagtagcagcaagcctcgagtgatccgggaagtacgagctgactctgtggggaaattg
ttaactgtgcgtggcattgtcactcgtgtgtctgaagtcaagcccaggatggtggtggcc
acatacacttgtgatcagtgtggggcagagacctaccagccaatccagtctcccactttc
atgcctctgatcatgtgccccagccaggagtgccagaccaatcgctcaggggggcggctg
tacctacagactcgtggctccaaatttgttaaattccaggaaatgaagattcaagagcat
agtgaccaagttcctgtgggaaacatccctcgtagcatcacagtggttctagaaggtgag
aacacaagaattgcccagcctggtgaccatgtcagcgtcactggcatcttcttgccagtc
ctgcgcacagggttccaacagatggcacagggcttactctcagaaacttacctggaagcc
cactggattgtgaagatgacaaagagtgacgatgatgtctctggggccggagagctgagc
tcagaggagctgaagcagattgcagaggaggatttctatgagaagctggccgcttctatt
gctccggagatctatggacatgaagatgtgaagaaggcgctgctgctgcttctggtgggt
ggtgtggaccagtctcctcaaggcatgaagatcagaggaaacatccacatctgccttatg
ggagaccctggtgtggccaaatctcagctcctatcttacatcgaccgtctggcaccgcga
agtcagtacacaacaggccgtggctcctctggtgtagggctcacagcagctgtgttgaga
gactctgtgagtggagaactgactttagagggcggtgccctggtgctggctgaccagggc
gtgtgctgcattgatgagtttgacaagatggccgaggctgaccgcacagccatccatgag
gttatggagcagcagaccatctccatcgccaaggcggggattctcaccacgctcaatgcc
cgatgctccatcctggctgcggccaatcctgcctacggccgatataatccccgccgcagt
ctggagcagaacgtccagcttccggctgctctgctttctcgattcgacctcctctggctg
attcaagaccggcccgacagagacaatgacctccggttggcccagcacatcacctatgtc
caccagcacagccggcagccccctgcccaatttgaacctttggacatgaaacttatgaga
cggtacatagccatgtgccacgagagacagcccacagtgcctgaatctctggctgactac
atcaccgcagcatatgtggagatgaggcgagaggcccgggccagtaaggatgccacctat
acttctgcccggaccctgctggccattctccgactttccactgctctggctcgacttcgg
atggtagacattgtggagaaggaagatgtaaatgaagccataaggttgatggagatgtcg
aaggactcccttctaggtgaaaagggacagacagctaggacccagaggccagcagatgtg
atatttgccaccatccgtgaattggtgtcacgggggcggagtgtccacttttctgaggct
gaacagcgctgcatatctcgtggcttcacaccagcccagttccaggcagctctggatgaa
tatgaggagctaaatgtctggcaggttaatacttctcggacacggatcacctttgtctga

DBGET integrated database retrieval system