KEGG   Mus musculus (mouse): 17420
Entry
17420             CDS       T01002                                 

Gene name
Mnat1, E130115E11Rik, MAT, MAT1, P36
Definition
(RefSeq) menage a trois 1
  KO
K10842  CDK-activating kinase assembly factor MAT1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03022  Basal transcription factors
mmu03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09121 Transcription
   03022 Basal transcription factors
    17420 (Mnat1)
  09124 Replication and repair
   03420 Nucleotide excision repair
    17420 (Mnat1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:mmu03021]
    17420 (Mnat1)
   03400 DNA repair and recombination proteins [BR:mmu03400]
    17420 (Mnat1)
Transcription machinery [BR:mmu03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     17420 (Mnat1)
DNA repair and recombination proteins [BR:mmu03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TFIIH complex
     17420 (Mnat1)
SSDB
Motif
Pfam: MAT1 zf-C3HC4_5 zf-RING_5 zf-RING_UBOX zf-C3HC4 DZR_2 zf-RING_2 zf-C3HC4_2 zf-UDP Prok-RING_4 zinc-ribbons_6 zf-RING_4 zf-P11 DNA_ligase_ZBD DUF1272
Other DBs
NCBI-GeneID: 17420
NCBI-ProteinID: NP_032638
MGI: 106207
Ensembl: ENSMUSG00000021103
Vega: OTTMUSG00000047017
UniProt: P51949
Position
12; 12 C3
AA seq 309 aa
MDDQGCPRCKTTKYRNPSLKLMVNVCGHTLCESCVDLLFVRGAGNCPECGTPLRKSNFRV
QLFEDPTVDKEVEIRKKVLKIYNKREEDFPSLREYNDFLEEVEEIVFNLTNNVDLENTKK
KMEIYQKENKDVIQKNKLKLTREQEELEEALEVERQEHEQRRLFIQKEEELQQALKRKNK
QAFLDELESSDLPVALLLAQHKDRSTQLEMQLEKPRSMKPVTFSTGIKMGQQISLAPIQK
LEEALYEYQPLQIETCGPQVPEQELLGRLGYLNHVRAASPQDLAGGYTSSLACHRALQDA
FSGLFWQPR
NT seq 930 nt   +upstreamnt  +downstreamnt
atggacgaccagggctgccccaggtgtaagaccaccaagtaccggaacccttctttgaag
ctgatggtgaacgtgtgcggacacactctgtgtgagagttgtgtggacttactgtttgta
agaggagctggaaactgtcctgagtgtgggactccactgagaaagagcaacttcagggta
caactctttgaagatcccactgttgataaggaggttgaaattcggaaaaaagtactaaag
atatacaataaaagggaagaagattttcctagtttaagagagtataatgattttctggaa
gaagtggaggaaatcgttttcaatttgaccaacaatgtggatttggagaacactaaaaag
aaaatggaaatatatcaaaaagaaaacaaagatgtcattcagaaaaacaaattaaagctg
acgcgggagcaggaggagttggaggaagcattggaggtagaacgccaagaacatgagcag
cgacggctgttcatacaaaaggaagaagagctgcagcaggctctgaaaaggaagaacaag
caggcctttttagatgagctggagagctccgacctccctgttgctctgctcctggcgcag
cataaagacagatcgacccagctggaaatgcagctcgagaagcccagatccatgaagcca
gtgacgttttccacaggaattaaaatgggtcaacagatttcattagcaccaatccaaaag
ctggaagaagctctttatgagtaccagcccctgcagatagagacctgtggcccacaagtt
cctgagcaagagctcttaggacggcttgggtatttaaaccacgtccgggctgcatctcca
caggatcttgctggcggctatacttcttctcttgcttgtcacagagcgctacaggatgcg
ttcagtgggctcttctggcagcccagataa

DBGET integrated database retrieval system