KEGG   Mus musculus (mouse): 17463
Entry
17463             CDS       T01002                                 

Gene name
Psmd7, AW107203, Mov, Mov-, Mov-34, Mov34
Definition
(RefSeq) proteasome (prosome, macropain) 26S subunit, non-ATPase, 7
  KO
K03038  26S proteasome regulatory subunit N8
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03050  Proteasome
mmu05010  Alzheimer disease
mmu05012  Parkinson disease
mmu05014  Amyotrophic lateral sclerosis
mmu05016  Huntington disease
mmu05017  Spinocerebellar ataxia
mmu05020  Prion disease
mmu05022  Pathways of neurodegeneration - multiple diseases
mmu05169  Epstein-Barr virus infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    17463 (Psmd7)
 09160 Human Diseases
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    17463 (Psmd7)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    17463 (Psmd7)
   05012 Parkinson disease
    17463 (Psmd7)
   05014 Amyotrophic lateral sclerosis
    17463 (Psmd7)
   05016 Huntington disease
    17463 (Psmd7)
   05017 Spinocerebellar ataxia
    17463 (Psmd7)
   05020 Prion disease
    17463 (Psmd7)
   05022 Pathways of neurodegeneration - multiple diseases
    17463 (Psmd7)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:mmu03051]
    17463 (Psmd7)
Proteasome [BR:mmu03051]
 Eukaryotic proteasome
  Regulatory particles
   PA700 (19S proteasome)
    non-ATPase subunits
     17463 (Psmd7)
SSDB
Motif
Pfam: MitMem_reg JAB Coilin_N Connexin
Other DBs
NCBI-GeneID: 17463
NCBI-ProteinID: NP_034947
MGI: 1351511
Ensembl: ENSMUSG00000039067
Vega: OTTMUSG00000061936
UniProt: P26516 A1L3B8
Position
8 D3; 8 54.38 cM
AA seq 321 aa
MPELAVQKVVVHPLVLLSVVDHFNRIGKVGNQKRVVGVLLGSWQKKVLDVSNSFAVPFDE
DDKDDSVWFLDHDYLENMYGMFKKVNARERIVGWYHTGPKLHKNDIAINELMKRYCPNSV
LVIIDVKPKDLGLPTEAYISVEEVHDDGTPTSKTFEHVTSEIGAEEAEEVGVEHLLRDIK
DTTVGTLSQRITNQVHGLKGLNSKLLDIRSYLEKVASGKLPINHQIIYQLQDVFNLLPDA
SLQEFVKAFYLKTNDQMVVVYLASLIRSVVALHNLINNKIANRDAEKKEGQEKEESKKER
KDDKEKEKSDAAKKEEKKEKK
NT seq 966 nt   +upstreamnt  +downstreamnt
atgccggagctggcggtgcagaaggtggtggttcaccccctggtgctgctcagtgtggtg
gatcatttcaaccgaattggcaaggttggaaaccagaagcgggtagttggtgtgcttttg
ggatcatggcaaaagaaagtacttgatgtatccaacagttttgcagtaccttttgatgaa
gatgacaaagatgattctgtctggtttttagaccatgattatttggaaaacatgtatggg
atgttcaagaaggtcaatgccagagaaaggatagttgggtggtaccacacaggccccaaa
ctgcacaagaatgatatcgccatcaatgaactcatgaagagatactgccccaactcagta
ttggtcattatcgacgtgaagccaaaggacctaggacttcccaccgaagcctacatctca
gtggaggaagttcatgacgatgggacgccaacgtcaaaaacttttgagcatgtgactagc
gagattggagcagaggaggcggaggaagtcggagtggagcacttactaagagacatcaag
gacactacagtggggactctctcccagcggatcacaaaccaggtccatggcttgaaggga
ctgaactccaagctcctggatatcaggagctacctggagaaggtagccagcggcaagctg
cccatcaaccaccagatcatataccagctgcaggacgtcttcaacctgctgccggacgcc
agcctgcaggagtttgtcaaggccttctacctgaagaccaatgaccagatggtggtggtg
tacctggcctcgctgatccgctctgtggtcgccttgcataacctcatcaacaacaagatt
gccaaccgggatgccgagaagaaggagggacaggaaaaggaggagagcaagaaggagaga
aaagacgacaaagagaaggagaagagcgacgcagcgaagaaagaagagaaaaaggagaaa
aagtaa

DBGET integrated database retrieval system