KEGG   Mus musculus (mouse): 18088
Entry
18088             CDS       T01002                                 

Gene name
Nkx2-2, Nkx-2., Nkx-2.2, Nkx2., Nkx2.2, ti, tinman
Definition
(RefSeq) NK2 homeobox 2
  KO
K08029  homeobox protein Nkx-2.2
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04950  Maturity onset diabetes of the young
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04950 Maturity onset diabetes of the young
    18088 (Nkx2-2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    18088 (Nkx2-2)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain ANTP: NKL
    18088 (Nkx2-2)
SSDB
Motif
Pfam: Homeodomain Homeobox_KN
Other DBs
NCBI-GeneID: 18088
NCBI-ProteinID: NP_035049
MGI: 97347
Ensembl: ENSMUSG00000027434
Vega: OTTMUSG00000045623
UniProt: P42586 Q3URZ4
Position
2 G2; 2 72.63 cM
AA seq 273 aa
MSLTNTKTGFSVKDILDLPDTNDEDGSVAEGPEEESEGPEPAKRAGPLGQGALDAVQSLP
LKSPFYDSSDNPYTRWLASTEGLQYSLHGLAASAPPQDSSSKSPEPSADESPDNDKETQG
GGGDAGKKRKRRVLFSKAQTYELERRFRQQRYLSAPEREHLASLIRLTPTQVKIWFQNHR
YKMKRARAEKGMEVTPLPSPRRVAVPVLVRDGKPCHALKAQDLAAATFQAGIPFSAYSAQ
SLQHMQYNAQYSSASTPQYPTAHPLVQAQQWTW
NT seq 822 nt   +upstreamnt  +downstreamnt
atgtcgctgaccaacacaaagacggggttttcagtcaaggacatcttggaccttccggac
accaacgatgaagacggctcggtggccgaagggccagaggaggagagcgaagggccggag
cccgccaagagggccgggccgctggggcagggcgccctggacgctgtgcagagcctgccc
cttaagagccctttctacgacagcagcgacaacccctacactcgctggctggccagcacc
gagggcctccaatactccctgcacgggctggcggccagcgctcccccccaagactcgagc
tccaaatccccagagccctcggctgacgagtcaccggacaatgacaaggagacccagggc
ggcgggggggacgcaggcaagaagcggaagcgccgagtgctcttctccaaagcgcagacc
tacgagctggagcggcgcttccggcagcagcggtacctgtcggcgcccgagcgcgagcac
ctggccagcctcatccgtctcacgccgacacaggtcaagatctggttccagaaccatcgc
tacaagatgaaacgtgcccgggcggagaaaggtatggaggtgacgcctctgccctcgccg
cgccgtgtggcagtgccggtcttggtcagggacggcaaaccgtgccacgcgctcaaagcc
caggacctggcagccgccaccttccaggcaggcatccccttttccgcctacagcgcgcag
tcgctgcagcacatgcagtacaacgcccagtacagctcggccagcaccccccagtacccg
acagcacaccccctggtccaggcccagcagtggacttggtga

DBGET integrated database retrieval system