KEGG   Mus musculus (mouse): 18479
Entry
18479             CDS       T01002                                 

Gene name
Pak1, AW045634, P, PAK, PAK-1, Paka
Definition
(RefSeq) p21 (RAC1) activated kinase 1
  KO
K04409  p21-activated kinase 1 [EC:2.7.11.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04010  MAPK signaling pathway
mmu04012  ErbB signaling pathway
mmu04014  Ras signaling pathway
mmu04024  cAMP signaling pathway
mmu04062  Chemokine signaling pathway
mmu04360  Axon guidance
mmu04392  Hippo signaling pathway - multiple species
mmu04510  Focal adhesion
mmu04625  C-type lectin receptor signaling pathway
mmu04650  Natural killer cell mediated cytotoxicity
mmu04660  T cell receptor signaling pathway
mmu04666  Fc gamma R-mediated phagocytosis
mmu04810  Regulation of actin cytoskeleton
mmu05132  Salmonella infection
mmu05170  Human immunodeficiency virus 1 infection
mmu05205  Proteoglycans in cancer
mmu05211  Renal cell carcinoma
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    18479 (Pak1)
   04012 ErbB signaling pathway
    18479 (Pak1)
   04014 Ras signaling pathway
    18479 (Pak1)
   04392 Hippo signaling pathway - multiple species
    18479 (Pak1)
   04024 cAMP signaling pathway
    18479 (Pak1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    18479 (Pak1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    18479 (Pak1)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    18479 (Pak1)
   04650 Natural killer cell mediated cytotoxicity
    18479 (Pak1)
   04660 T cell receptor signaling pathway
    18479 (Pak1)
   04666 Fc gamma R-mediated phagocytosis
    18479 (Pak1)
   04062 Chemokine signaling pathway
    18479 (Pak1)
  09158 Development and regeneration
   04360 Axon guidance
    18479 (Pak1)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    18479 (Pak1)
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    18479 (Pak1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    18479 (Pak1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    18479 (Pak1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    18479 (Pak1)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    18479 (Pak1)
   03036 Chromosome and associated proteins [BR:mmu03036]
    18479 (Pak1)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     18479 (Pak1)
Protein kinases [BR:mmu01001]
 Serine/threonine kinases: STE group
  STE20 family
   18479 (Pak1)
Membrane trafficking [BR:mmu04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    18479 (Pak1)
 Endocytosis
  Macropinocytosis
   Kinases
    18479 (Pak1)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     18479 (Pak1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PBD Kinase-like Pkinase_fungal APH DSHCT Kdo
Other DBs
NCBI-GeneID: 18479
NCBI-ProteinID: NP_001344291
MGI: 1339975
Ensembl: ENSMUSG00000030774
Vega: OTTMUSG00000021135
Position
7 E1; 7 53.57 cM
AA seq 552 aa
MSNNGVDIQDKPPAPPMRNTSTMIGAGSKDTGTLNHGSKPLPPNPEEKKKKDRFYRSILP
GDKTNKKKEKERPEISLPSDFEHTIHVGFDAVTGEFTGMPEQWARLLQTSNITKSEQKKN
PQAVLDVLEFYNSKKTSNSQKYMSFTDKSAEDYNSSNTLNVKTVSETPAVPPVSEDEDDD
DDATPPPVIAPRPEHTKSFGQKDQREVYTRSVIEPLPVTPTRDVATSPISPTENNTTPPD
ALTRNTEKQKKKPKMSDEEILEKLRSIVSVGDPKKKYTRFEKIGQGASGTVYTAMDVATG
QEVAIKQMNLQQQPKKELIINEILVMRENKNPNIVNYLDSYLVGDELWVVMEYLAGGSLT
DVVTETCMDEGQIAAVCRECLQALEFLHSNQVIHRDIKSDNILLGMDGSVKLTDFGFCAQ
ITPEQSKRSTMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMIEGEPPYLNENPLRAL
YLIATNGTPELQNPEKLSAIFRDFLNRCLEMDVEKRGSAKELLQHQFLKIAKPLSSLTPL
IAAAKEATKNNH
NT seq 1659 nt   +upstreamnt  +downstreamnt
atgtcaaataacggcgtagacatccaggacaaacccccagcccctccgatgagaaacacc
agcactatgattggagccggcagcaaagacactggaaccctaaaccacggctccaaacct
ctgcctccaaacccagaggagaagaaaaagaaggaccggttttatcgatccatcttacct
ggagataaaacaaataaaaagaaggagaaggagcgaccagagatttctcttccttcagat
tttgagcatacaattcatgttggttttgatgctgtcacaggggagtttacgggaatgcca
gaacagtgggctcgcttgcttcaaacatcaaatatcacaaagtcagaacagaagaaaaac
ccacaggctgttctggatgtgttggaattttataactctaagaagacctccaatagtcag
aagtacatgagttttacagataagtcagctgaagattataattcttctaacactttgaat
gtgaagactgtgtctgagaccccagcagtaccaccagtgtcagaagatgaagatgatgat
gacgatgctaccccacctccagtgattgctccacgcccagaacacacaaaatcttttggg
cagaaggatcagagagaggtatatacacgatctgtgattgaaccacttcctgttactcca
actcgggatgtggctacatctcctatttctcctactgagaataacaccactccgccagat
gctttgacccggaacacggaaaaacagaagaagaagcctaaaatgtctgatgaggagatc
ttagagaaattacggagcatagtgagtgtgggtgatcctaagaagaagtacacacggttc
gagaagattggacaaggtgcttcaggcacagtgtatactgcaatggatgtagccacaggg
caggaggtggccattaaacagatgaatcttcagcagcagccgaagaaagagctgattatt
aatgagatcctggtcatgagggaaaacaaaaacccaaatattgtcaactacctggacagt
taccttgtgggagatgagctgtgggttgttatggaatacttggctggaggctccttgaca
gatgtggtgacagaaacctgtatggatgaaggccagatagcagctgtgtgccgagagtgt
ctacaagctttggagtttctacattcaaaccaagtcattcacagggacatcaagagtgac
aatattctgctgggaatggatggctctgtcaagttaactgactttggattctgtgcacag
ataactccagagcagagcaaaaggagcaccatggtgggaactccatattggatggcacct
gaagttgtgacacgcaaggcctatggacccaaggttgacatctggtccctgggcattatg
gcaattgaaatgattgagggggagcccccatacctcaatgaaaaccctttgagagccttg
tacctcattgctaccaatgggacgccagagcttcagaacccagagaagttgtcagctatt
ttccgggacttcctgaaccgctgtcttgagatggatgtggagaagagaggctcagctaaa
gagctgctgcagcatcagttcctgaagattgccaagcccctctctagcctgactccactg
attgctgcagcaaaagaggcaaccaagaacaatcactga

KEGG   Mus musculus (mouse): 18481
Entry
18481             CDS       T01002                                 

Gene name
Pak3, PAK, PAK-3, Pak65alpha, Pak65beta, Stk4
Definition
(RefSeq) p21 (RAC1) activated kinase 3
  KO
K05733  p21-activated kinase 3 [EC:2.7.11.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04012  ErbB signaling pathway
mmu04014  Ras signaling pathway
mmu04360  Axon guidance
mmu04510  Focal adhesion
mmu04660  T cell receptor signaling pathway
mmu04810  Regulation of actin cytoskeleton
mmu05132  Salmonella infection
mmu05170  Human immunodeficiency virus 1 infection
mmu05211  Renal cell carcinoma
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    18481 (Pak3)
   04014 Ras signaling pathway
    18481 (Pak3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    18481 (Pak3)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    18481 (Pak3)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    18481 (Pak3)
  09158 Development and regeneration
   04360 Axon guidance
    18481 (Pak3)
 09160 Human Diseases
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    18481 (Pak3)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    18481 (Pak3)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    18481 (Pak3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    18481 (Pak3)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     18481 (Pak3)
Protein kinases [BR:mmu01001]
 Serine/threonine kinases: STE group
  STE20 family
   18481 (Pak3)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PBD Pkinase_fungal Kinase-like Spt5_N APH DSHCT Kdo
Other DBs
NCBI-GeneID: 18481
NCBI-ProteinID: NP_001181977
MGI: 1339656
Ensembl: ENSMUSG00000031284
Vega: OTTMUSG00000018957
UniProt: Q61036
Structure
PDB: 
1EES

Position
X; X F2
AA seq 559 aa
MSDSLDNEEKPPAPPLRMNSNNRDSSALNHSSKPLPMAPEEKNKKARLRSIFPGGGDKTN
KKKEKERPEISLPSDFEHTIHVGFDAVTGEFTPDLYGSQMCPGKLPEGIPEQWARLLQTS
NITKLEQKKNPQAVLDVLKFYDSKETVNNQKYMSFTSGDKSAHGYIAAHQSNTKTASEPP
LAPPVSEEEDEEEEEEEDDNEPPPVIAPRPEHTKSIYTRSVVESIASPAAPNKEDIPPSA
ENANSTTLYRNTDRQRKKSKMTDEEILEKLRSIVSVGDPKKKYTRFEKIGQGASGTVYTA
LDIATGQEVAIKQMNLQQQPKKELIINEILVMRENKNPNIVNYLDSYLVGDELWVVMEYL
AGGSLTDVVTETCMDEGQIAAVCRECLQALDFLHSNQVIHRDIKSDNILLGMDGSVKLTD
FGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMVEGEPPYLNE
NPLRALYLIATNGTPELQNPERLSAVFRDFLNRCLEMDVDRRGSAKELLQHPFLKLAKPL
SSLTPLIIAAKEAIKNSSR
NT seq 1680 nt   +upstreamnt  +downstreamnt
atgtctgacagcttggataacgaagaaaaacccccagctcccccactgaggatgaacagt
aacaaccgagactcttcagcactcaaccacagctccaaaccactgcccatggccccggaa
gagaagaataagaaagccaggcttcgctctatcttcccaggaggaggggataaaaccaat
aagaagaaagagaaagagcgcccagagatctctcttccttcagactttgagcatacgatt
catgtgggttttgatgcagtcaccggggaattcactccagatctctatggctcacagatg
tgcccagggaagctcccagagggaattcctgagcaatgggcacgactactccaaacctcc
aacataacaaagctggaacagaagaagaacccacaagctgttcttgatgttctcaagttc
tacgactccaaagaaacggtcaacaaccagaaatatatgagctttacgtcaggagataaa
agtgcccatggatacatagcagcacatcagtcgaataccaaaacagcttcggaacctcct
ttggctcctcctgtatctgaagaagaggatgaagaagaggaagaggaagaagatgacaat
gaacctccgcctgtcattgcaccaagaccagagcatacaaaatcaatctatactcgctcc
gtggttgagtcaattgcttcaccagctgcaccaaataaagaagatatcccaccttctgct
gagaatgccaattccaccactttgtacaggaatacagatcggcaaagaaaaaagtccaag
atgacggatgaggagatcctagagaagctgagaagcattgtgagtgttggggacccaaag
aagaaatatacgagatttgaaaaaattggccaaggggcatcaggaactgtttacacagca
ctagacattgcgactggacaagaggtggccataaagcaaatgaaccttcaacagcagccc
aaaaaggaattaattattaatgaaattcttgtcatgagggaaaataagaaccccaatatt
gtcaattatttagatagctacttagtgggtgatgaactgtgggtagtcatggaatacttg
gctggtggctctttgactgatgtggtcacagaaacctgtatggatgaaggacagatagca
gctgtctgtagagagtgcctccaagctttggatttcttgcactcaaaccaagtgatccac
agagacataaagagcgacaacattctcctcgggatggatggttctgttaaactgactgat
tttgggttctgtgctcaaatcactcctgagcaaagtaaacgaagcactatggtgggaact
ccctattggatggcacctgaagtggtaactcgaaaagcttatggtccaaaagttgatatc
tggtctctgggaatcatggccattgaaatggtggaaggtgaacccccttaccttaatgaa
aatccactcagggccttatatctgatagccactaatgggaccccagagctccagaatcct
gagagactgtcagctgtattccgtgacttcttaaatcgctgtcttgagatggatgtggat
agaagaggatctgctaaggagcttttgcagcatccgtttttaaaattagccaagcctctg
tctagtctcactcctctgattatcgccgcaaaggaagcaattaagaacagtagccgttag

KEGG   Mus musculus (mouse): 214230
Entry
214230            CDS       T01002                                 

Gene name
Pak6, 4732456M09
Definition
(RefSeq) p21 (RAC1) activated kinase 6
  KO
K05735  p21-activated kinase 6 [EC:2.7.11.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04012  ErbB signaling pathway
mmu04014  Ras signaling pathway
mmu04360  Axon guidance
mmu04510  Focal adhesion
mmu04660  T cell receptor signaling pathway
mmu04810  Regulation of actin cytoskeleton
mmu05170  Human immunodeficiency virus 1 infection
mmu05211  Renal cell carcinoma
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    214230 (Pak6)
   04014 Ras signaling pathway
    214230 (Pak6)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    214230 (Pak6)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    214230 (Pak6)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    214230 (Pak6)
  09158 Development and regeneration
   04360 Axon guidance
    214230 (Pak6)
 09160 Human Diseases
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    214230 (Pak6)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    214230 (Pak6)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    214230 (Pak6)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     214230 (Pak6)
Protein kinases [BR:mmu01001]
 Serine/threonine kinases: STE group
  STE20 family
   214230 (Pak6)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PBD Kinase-like Pkinase_fungal Kdo
Other DBs
NCBI-GeneID: 214230
NCBI-ProteinID: NP_001028426
MGI: 2679420
Ensembl: ENSMUSG00000074923
Vega: OTTMUSG00000015368
UniProt: Q3ULB5
Position
2; 2 E5
AA seq 682 aa
MFRKKKKKRPEISAPQNFQHRVHTSFDPKEGKFVGLPPQWQNILDTLRRPKPVVDPSRIT
RVQLQPMKTVVRGSSVPTEGYISGLLNDIQKLSVISSNTLRGRSPTSRRRAQSLGLLGDD
QWAADPDMYLQSPQSEHTDPHGLYLSCNGGTPAGHRQVPWPEPQSPQALPNGMAAKAQSL
GPAEFQGASQRCLQQLGACLQSSPPGTSPPMATGRRGVKVAKHSSEEARPQSCLVGSAIG
RPGGEGSPSPKNQESSLKHRLFRSMFLSTPATGAASSSKPVPLPQNKPNSAFRPPQKDSS
SNLVAKAQSLPSEQPMGTFSPLTTSDTSSPQKSLRTAPAAGPLPGRSSPAGSPRTRHAQI
STSNLYLPQDPTVAKGALGGEDTGIVTHEQFKAALRMVVDQGDPRLLLDSYVKIGEGSTG
IVCLAREKHSGRQVAVKMMDLRKQQRRELLFNEVVIMRDYQHLNVVEMYKSYLVGEELWV
LMEFLQGGALTDIISQVRLNEEQIATVCEAVLQALAYLHAQGVIHRDIKSDSILLTLDGR
VKLSDFGFCAQISKDVPKRKSLVGTPYWMAPEVISRSLYATEVDIWSLGIMVIEMVDGEP
PYFSDSPVQAMKRLRDSAPPKLKNSYKVSPVLRDFLDRMLVREPQERATAQELLDHPFLL
QTGLPECLVPLIQLYRKQTSTC
NT seq 2049 nt   +upstreamnt  +downstreamnt
atgttccgcaagaaaaagaagaaacgtcctgagatatcagccccgcagaacttccagcat
cgtgtccacacctcctttgaccccaaggaaggcaagtttgtgggtctgcccccacaatgg
cagaacattctggatactctgaggcggcccaagcctgtggtggatccttctcgaatcaca
cgggtgcagttgcagcccatgaagacagtggtacggggcagctcagtgcccacggagggc
tacatctccgggctgctcaacgacattcagaagttgtcagttatcagctccaacaccctg
cgtggacgcagccccaccagccggcggcgggcacagtccctggggctgctgggagatgat
cagtgggctgctgaccccgatatgtacctccaaagcccccagtcggagcacactgatccc
catggcctctacctcagctgcaatgggggcacaccagcaggtcacaggcaggtgccctgg
ccagaaccacagagcccgcaggccctgcccaatgggatggctgccaaggcgcagtcactg
ggccctgctgagttccagggtgcctcacaacgctgcctgcagcagctgggtgcctgcctg
cagagttccccacccggtacctcaccccctatggccacagggaggcgtggggtgaaggtt
gccaagcatagctccgaagaggcccggcctcagtcctgcctggtgggctccgccattggc
aggccaggtggagaaggcagccctagccctaagaaccaggaaagcagcctcaagcaccgg
ctcttccgaagcatgttcctgtccactcctgccacaggcgcggcaagcagcagcaagccg
gtccctctgccacagaacaagcccaattctgctttccgaccaccacaaaaagactcctct
tcaaacctggtagccaaggcccagtccttgccctcagagcagcccatggggaccttcagt
cctctgaccacctcagataccagcagcccccagaagtccctccgcacagctccagccgct
ggtccacttccaggccggtcttctccagcaggctccccccgtacccggcatgctcagatc
agcaccagcaatctctacctgccccaggaccccacagtggccaagggggccctgggtggc
gaagacacgggcattgtgacccatgaacagttcaaggctgcgctcaggatggtggtggac
cagggtgaccctcggctgctgctggacagctacgtgaagattggggagggctccacgggc
attgtgtgtctggcccgggagaagcactcaggtcgccaggtagcagtcaagatgatggac
ctcaggaagcagcaacgcagggagctgctctttaatgaggtggtgatcatgcgtgactac
cagcacctcaacgtggtggagatgtacaagagttacctggtaggagaggagctgtgggtg
ttgatggagttcctgcagggcggggccctcacagacatcatctcccaagtcagactgaat
gaggagcagattgccactgtgtgtgaagctgtgcttcaggccttggcttacctgcacgcc
cagggtgtcatccaccgagatatcaagagtgattccatcctgctgacccttgatggcagg
gtgaagctctcagactttgggttctgtgctcagatcagcaaagatgttcccaagagaaag
tccctggtaggaactccatactggatggctcctgaagtgatctccagatccctgtacgct
actgaggtggatatctggtctctgggcatcatggtgattgagatggtggatggagaaccc
ccctacttcagtgactccccagtgcaagccatgaagaggctgcgggacagcgccccaccc
aagctaaagaactcttacaaggtctctccagtgctgcgagacttcctggatcggatgctg
gtacgggaaccccaagagcgagccacggcccaggagcttctggatcacccgtttctgctg
cagacggggctgcctgagtgtctggtgcctctgatacagctctaccgcaagcagacctcc
acctgctga

KEGG   Mus musculus (mouse): 224105
Entry
224105            CDS       T01002                                 

Gene name
Pak2, 5330420P17Rik, A130002K10Rik, AI836325, D16Ertd269, D16Ertd269e, PAK, PAK-2, mKIAA4182
Definition
(RefSeq) p21 (RAC1) activated kinase 2
  KO
K04410  p21-activated kinase 2 [EC:2.7.11.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04010  MAPK signaling pathway
mmu04012  ErbB signaling pathway
mmu04014  Ras signaling pathway
mmu04360  Axon guidance
mmu04510  Focal adhesion
mmu04660  T cell receptor signaling pathway
mmu04810  Regulation of actin cytoskeleton
mmu05170  Human immunodeficiency virus 1 infection
mmu05211  Renal cell carcinoma
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    224105 (Pak2)
   04012 ErbB signaling pathway
    224105 (Pak2)
   04014 Ras signaling pathway
    224105 (Pak2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    224105 (Pak2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    224105 (Pak2)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    224105 (Pak2)
  09158 Development and regeneration
   04360 Axon guidance
    224105 (Pak2)
 09160 Human Diseases
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    224105 (Pak2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    224105 (Pak2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    224105 (Pak2)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     224105 (Pak2)
Protein kinases [BR:mmu01001]
 Serine/threonine kinases: STE group
  STE20 family
   224105 (Pak2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PBD Kinase-like Pkinase_fungal APH Kdo zinc-ribbons_6
Other DBs
NCBI-GeneID: 224105
NCBI-ProteinID: NP_796300
MGI: 1339984
Ensembl: ENSMUSG00000022781
Vega: OTTMUSG00000023944
UniProt: Q8CIN4 Q5DTJ2
Position
16 B2; 16 22.4 cM
AA seq 524 aa
MSDNGELEDKPPAPPVRMSSTIFSTGGKDPLSANHSLKPLPSVPEEKKPRNKIISIFSGT
EKGSKKKEKERPEISPPSDFEHTIHVGFDAVTGEFTGMPEQWARLLQTSNITKLEQKKNP
QAVLDVLKFYDSNTVKQKYLSFTPPEKDGFPSGTPALNTKGSETSAVVTEEDDDDEDAAP
PVIAPRPDHTKSIYTRSVIDPIPAPVGDSNVDSGAKSSDKQKKKAKMTDEEIMEKLRTIV
SIGDPKKKYTRYEKIGQGASGTVFTATDVALGQEVAIKQINLQKQPKKELIINEILVMKE
LKNPNIVNFLDSYLVGDELFVVMEYLAGGSLTDVVTETCMDEAQIAAVCRECLQALEFLH
ANQVIHRDIKSDNVLLGMEGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKAY
GPKVDIWSLGIMAIEMVEGEPPYLNENPLRALYLIATNGTPELQNPEKLSPIFRDFLNRC
LEMDVEKRGSAKELLQHPFLKLAKPLSSLTPLILAAKEAMKSNR
NT seq 1575 nt   +upstreamnt  +downstreamnt
atgtctgataacggagagctagaagacaagcccccagcacctccagttcggatgagcagt
accatttttagcaccggaggaaaagatcctttatcagccaatcacagtttgaaacctttg
ccttctgttccagaggaaaaaaaacccaggaacaaaatcatctccatattctctggcaca
gaaaaaggaagtaaaaagaaagaaaaagaacggccagagatttctcccccatctgatttt
gagcacaccatccatgttggctttgatgctgttacgggagagttcactggcatgccagaa
cagtgggcgcggctgttgcagacctccaacattaccaaactcgagcagaagaagaaccct
caggcagtgctggatgtcttgaagttctacgactccaacactgtgaaacagaagtacctg
agtttcactcctcctgagaaagatggcttcccttctggaacaccagcactgaacaccaag
gggtcagagacatcagctgtagtgacagaggaagatgatgatgatgaagacgctgctcct
cccgtcattgcccctcggccagatcatacaaaatcaatttacacacggtctgtcatcgac
cccattcctgctccagttggtgattctaatgttgacagtggtgccaagtcttcagacaaa
cagaaaaagaaagccaagatgaccgatgaagagattatggagaaattaagaactattgtg
agcataggggacccaaagaaaaaatacacaagatatgaaaaaattgggcaaggggcttct
ggaacagtttttactgccactgatgtggccctggggcaagaggttgctatcaagcagatt
aatttacagaaacaaccaaagaaggaattgatcattaatgaaattctggtgatgaaagag
ttaaagaatcccaacatagttaacttcttggacagttacctggtaggagatgagttgttt
gtggtaatggagtacctcgctggtgggtccctcactgatgttgtaacagaaacctgcatg
gacgaagcgcagattgccgccgtgtgcagagagtgtttacaggcgttggagtttttacat
gctaatcaagtgatccacagagacatcaaaagtgacaatgtgcttttgggaatggaaggc
tcagttaaacttactgacttcggcttctgtgcccagatcactcctgaacagagcaaacgc
agtactatggttggaacaccgtactggatggcaccagaggtggtgacacggaaagcctat
ggtcccaaagttgacatatggtctctgggcatcatggctatcgagatggttgaaggagag
cctccatacctcaacgaaaatcctctgcgggcattatacctgatagctacaaatggaact
cctgaacttcagaatccagaaaaactttccccaatatttcgggatttcttaaatcggtgt
ttggaaatggatgtggagaaaaggggttcggccaaggaactgttacagcatcctttcctg
aaactggccaaaccattgtctagcttgacgccactgatcctggcagctaaagaagcaatg
aagagtaaccgctaa

KEGG   Mus musculus (mouse): 241656
Entry
241656            CDS       T01002                                 

Gene name
Pak5, 2900083L08Rik, PAK-5, PAK-7, Pa, Pak7
Definition
(RefSeq) p21 (RAC1) activated kinase 5
  KO
K05736  p21-activated kinase 5 [EC:2.7.11.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04012  ErbB signaling pathway
mmu04014  Ras signaling pathway
mmu04360  Axon guidance
mmu04510  Focal adhesion
mmu04660  T cell receptor signaling pathway
mmu04810  Regulation of actin cytoskeleton
mmu05170  Human immunodeficiency virus 1 infection
mmu05211  Renal cell carcinoma
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    241656 (Pak5)
   04014 Ras signaling pathway
    241656 (Pak5)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    241656 (Pak5)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    241656 (Pak5)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    241656 (Pak5)
  09158 Development and regeneration
   04360 Axon guidance
    241656 (Pak5)
 09160 Human Diseases
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    241656 (Pak5)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    241656 (Pak5)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    241656 (Pak5)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     241656 (Pak5)
Protein kinases [BR:mmu01001]
 Serine/threonine kinases: STE group
  STE20 family
   241656 (Pak5)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PBD Kinase-like Pkinase_fungal
Other DBs
NCBI-GeneID: 241656
NCBI-ProteinID: NP_766446
MGI: 1920334
Ensembl: ENSMUSG00000039913
Vega: OTTMUSG00000015988
UniProt: Q8C015
Position
2; 2 F3
AA seq 719 aa
MFGKKKKKIEISGPSNFEHRVHTGFDPQEQKFTGLPQQWHSLLADTANRPKPMVDPSCIT
PIQLAPMKTIVRGNKSCKETSINGLLEDFDNISVTRSNSLRKESPPTPDQGAASRIQGHS
EENGFITFSQYSSESDTTADYTTEKYRDRSLYGDDLDLYYKSSHAAKQNGHAMKMKHGDA
YYPEMKSLKTDLAGFPVDYHTHLDSLRKSSEYGDLRWDYQRASSSSPLDYSFQLTPSRTA
GTSRCSKESLAYSESDWGPSLDDYDRRPKSSYLHQTSPQPAMRQRSKSGSGLQEPMMPFG
ASAFKTHPQGHSYNSYTYPRLSEPTMCIPKVDYDRAQMVFSPPLSGSDTYPRGPTKLPQS
QSKAGYSSGSHQYPSGYHKASLYHHPSLQTSSQYISTASYLSSLSISSSTYPPPSWGSSS
DQQPSRVSHEQFRAALQLVVSPGDPREYLDNFIKIGEGSTGIVCIATEKHTGKQVAVKKM
DLRKQQRRELLFNEVVIMRDYHHDNVVDMYNSYLVGDELWVVMEFLEGGALTDIVTHTRM
NEEQIATVCLSVLKALSYLHNQGVIHRDIKSDSILLTSDGRIKLSDFGFCAQVSKEVPKR
KSLVGTPYWMAPEVISRLPYGTEVDIWSLGIMVIEMIDGEPPYFNEPPLQAMRRIRDSLP
PRVKDLHKVSSMLRGFLDLMLVREPSQRATAQELLGHPFLKLAGPPSCIVPLMRQYRHH
NT seq 2160 nt   +upstreamnt  +downstreamnt
atgtttgggaagaaaaagaaaaagatcgaaatatctggcccatccaactttgaacacagg
gttcatactggatttgatccacaagagcagaagtttactggccttccccagcagtggcac
agcctgttagcagacacagccaacaggcccaagcccatggtggacccatcatgcatcaca
cccatacagctggctcccatgaagacaatcgtcagaggaaataaatcctgcaaggaaacc
tctatcaatggtctgctagaggattttgacaacatctccgtgactcgctccaactctcta
aggaaagaaagcccacccaccccagatcagggagcagctagccgcattcaaggccactcg
gaagagaacggcttcatcactttctcacaatattccagtgaatccgatacgactgcggac
tacacaactgaaaagtacagagacaggagtctctatggagatgacctggatctgtactat
aaaagcagccatgcagccaagcaaaatgggcatgccatgaagatgaaacatggagacgct
tactaccctgagatgaagtctttgaaaaccgacctggccggattccctgtcgactatcac
acccacttggactctctgagaaaatcaagtgaatatggtgaccttaggtgggattatcag
agagcctctagtagctcccctctggactactcattccagctcacgccttctagaactgca
gggaccagcaggtgctccaaggagagtctggcatacagtgaaagtgattggggacccagc
ctggatgactatgacaggaggccaaaatcatcatacctgcatcagacgagccctcagcca
gccatgcgccagagatccaagtccggctcagggcttcaggaacccatgatgccatttgga
gcaagtgcatttaaaactcatcctcaaggacactcgtacaactcctacacctaccctcga
ttgtccgagcccacaatgtgcattccaaaggtggattacgatcgagcacagatggtcttc
agtcctccactgtcagggtccgacacttaccccagaggccccaccaaactacctcaaagt
caaagcaaagcaggctactcttcaggcagccaccagtacccttctgggtaccacaaagca
tctctataccaccatccatccctgcaaaccagttctcagtacatctccaccgcttcttac
ttaagctctctcagtatctcctcgagcacctaccctccacctagctggggctcctcctca
gaccagcagccctcaagggtatcccatgaacaattccgagctgccctgcaactggtggtc
agcccaggagaccccagggaatatttggataactttattaaaatcggagaagggtcgaca
ggcatcgtgtgcattgcaacagagaaacacacaggcaagcaagtggcagtgaagaaaatg
gacctccgaaagcagcagagacgggaactcctttttaatgaggtcgtgataatgcgtgat
taccaccatgacaacgtagttgacatgtacaacagctaccttgttggagatgagctctgg
gtggtcatggagtttctagaaggtggtgccttgacagacattgtcactcataccagaatg
aatgaagagcagatagctactgtctgcctgtcagttctgaaagctctgtcctaccttcat
aaccaaggagtgattcacagggacataaagagtgactccattcttctgacaagcgatggc
cggataaagttatctgactttggtttctgtgctcaagtttccaaagaggtgccaaagagg
aagtcactggtgggtaccccatactggatggcacctgaggtgatttccaggctaccttat
gggacagaggtggacatctggtccctcgggataatggtgatagagatgattgatggggag
cccccctatttcaatgagcctcctctgcaggccatgaggaggatccgggacagtttacct
ccaagagtgaaggacctacacaaggtttcttccatgctccgaggattcctagatcttatg
ttggtgagggagccctctcaaagagccacagctcaagaactccttggacatccattctta
aaattggcaggtccaccatcttgcattgttcctctcatgagacaatacagacatcactga

KEGG   Mus musculus (mouse): 70584
Entry
70584             CDS       T01002                                 

Gene name
Pak4, 5730488L07Rik, AW555722, mKIAA1142
Definition
(RefSeq) p21 (RAC1) activated kinase 4
  KO
K05734  p21-activated kinase 4 [EC:2.7.11.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04012  ErbB signaling pathway
mmu04014  Ras signaling pathway
mmu04360  Axon guidance
mmu04510  Focal adhesion
mmu04660  T cell receptor signaling pathway
mmu04810  Regulation of actin cytoskeleton
mmu05170  Human immunodeficiency virus 1 infection
mmu05206  MicroRNAs in cancer
mmu05211  Renal cell carcinoma
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    70584 (Pak4)
   04014 Ras signaling pathway
    70584 (Pak4)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    70584 (Pak4)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    70584 (Pak4)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    70584 (Pak4)
  09158 Development and regeneration
   04360 Axon guidance
    70584 (Pak4)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    70584 (Pak4)
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    70584 (Pak4)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    70584 (Pak4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    70584 (Pak4)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     70584 (Pak4)
Protein kinases [BR:mmu01001]
 Serine/threonine kinases: STE group
  STE20 family
   70584 (Pak4)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PBD Kinase-like Pkinase_fungal Kdo KIND
Other DBs
NCBI-GeneID: 70584
NCBI-ProteinID: NP_081746
MGI: 1917834
Ensembl: ENSMUSG00000030602
Vega: OTTMUSG00000025040
UniProt: Q8BTW9
Position
7; 7 A3- B1
AA seq 593 aa
MFGKKKKRVEISAPSNFEHRVHTGFDQHEQKFTGLPRQWQSLIEESARRPKPLIDPACIT
SIQPGAPKTIVRGSKGAKDGALTLLLDEFENMSVTRSNSLRRESPPPPARAHQENGMLEE
RAAPARMAPDKAGSRARATGHSEAGSGSGDRRRVGPEKRPKSSRDGPGGPQEASRDKRPL
SGPDVSTPQPGSLTSGTKLAAGRPFNTYPRADTDHPPRGAQGEPHTMAPNGPSATGLAAP
QSSSSSRPPTRARGAPSPGVLGPHASEPQLAPPARALAAPAVPPAPGPPGPRSPQREPQR
VSHEQFRAALQLVVDPGDPRSYLDNFIKIGEGSTGIVCIATVRSSGKLVAVKKMDLRKQQ
RRELLFNEVVIMRDYRHENVVEMYNSYLVGDELWVVMEFLEGGALTDIVTHTRMNEEQIA
AVCLAVLQALAVLHAQGVIHRDIKSDSILLTHDGRVKLSDFGFCAQVSKEVPRRKSLVGT
PYWMAPELISRLPYGPEVDIWSLGVMVIEMVDGEPPYFNEPPLKAMKMIRDNLPPRLKNL
HKASPSLKGFLDRLLVRDPAQRATAAELLKHPFLTKAGPPASIVPLMRQHRTR
NT seq 1782 nt   +upstreamnt  +downstreamnt
atgtttggaaagaagaagaagcgggtggagatctcagccccatccaacttcgagcaccgt
gtacacacaggctttgatcagcatgagcagaagttcacagggctgccccgccagtggcag
agcctgattgaggaatcagcacgcagacccaagcccctgatcgaccctgcctgcatcacg
tccatccagcctggagcccccaagaccatcgttcggggcagcaaaggtgccaaggatggg
gctctcactctgctgcttgacgaatttgagaacatgtcggtgacgcgctccaactcccta
cgcagagagagtccaccaccacctgcccgtgcccaccaggagaatggaatgctggaggag
cgggcagccccggccagaatggcccctgacaaagctggaagcagagcccgggccacaggc
cacagtgaggcaggcagtggcagtggtgacagacggcgggtggggccagagaaaaggccc
aaatcttcgagggatggtccaggaggaccccaggaggcctcccgcgataagcgcccactc
tctgggcctgatgtcagcactcctcagcctggcagtctgaccagcgggacaaaactagca
gctggcaggccctttaacacatacccacgggctgacacggaccacccaccccgcggtgcc
cagggggagccacataccatggcccctaatgggccttcagccacaggcctggccgctcct
cagtcttcctcctcctcccggcctcccacccgagcccgtggtgctcccagcccaggagtt
ctgggtccccatgcctctgagccccagttggcccccccagcacgtgcccttgctgcccct
gctgtacctcctgcccctgggccccctgggcctcgctcaccacagcgggagccccaacga
gtgtcccatgagcagttccgggctgccctgcagctggtggtggacccaggggaccctcgt
tcctatctagacaacttcatcaagattggtgagggctctacaggtattgtgtgcattgcc
actgtacgcagctcaggcaaactggtggccgtcaagaagatggacttgcgcaagcagcaa
agacgtgaactgctcttcaatgaggtggtgatcatgcgggactaccggcacgagaacgtg
gtggagatgtacaacagctacctggtgggtgacgaactctgggtcgtcatggagttcctg
gaaggcggcgccctcacggatattgtcacccacaccaggatgaacgaggaacagatcgcc
gccgtgtgcctggctgtgcttcaggcgctggctgtgctccacgcccagggtgtcatccac
cgtgacatcaagagtgactctatcttgctgacccatgatggccgggtgaagctgtccgac
ttcgggttttgtgcccaggtgagcaaggaggtgcctcggaggaagtcgctggtgggcacc
ccgtattggatggccccggagctcatctcccgccttccctatgggccagaggtggatatc
tggtcactgggggtgatggtgatcgagatggtggatggggagcccccttacttcaacgag
ccacccctcaaagctatgaagatgatccgggacaacctcccgccccgactgaagaacctg
cacaaggcgtcaccgtctctgaaaggcttcttggatcgcctgctagtgcgggacccggcc
cagcgggccactgctgccgagctgctgaagcacccgttcctcaccaaggcggggccacca
gccagcatcgtgcccctgatgcgccagcaccgaaccagatga

DBGET integrated database retrieval system