KEGG   Mus musculus (mouse): 18506
Entry
18506             CDS       T01002                                 

Gene name
Pax4, Pax, Pax-4
Definition
(RefSeq) paired box 4
  KO
K08032  paired box protein 4
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04950  Maturity onset diabetes of the young
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04950 Maturity onset diabetes of the young
    18506 (Pax4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    18506 (Pax4)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain Paired-related
    18506 (Pax4)
SSDB
Motif
Pfam: PAX Homeodomain HTH_32 HTH_23 HTH_28 HTH_38
Other DBs
NCBI-GeneID: 18506
NCBI-ProteinID: NP_035168
MGI: 97488
Ensembl: ENSMUSG00000029706
Vega: OTTMUSG00000035782
UniProt: P32115 A2RRY5
Position
6 A3.3; 6 11.99 cM
AA seq 349 aa
MQQDGLSSVNQLGGLFVNGRPLPLDTRQQIVQLAIRGMRPCDISRSLKVSNGCVSKILGR
YYRTGVLEPKCIGGSKPRLATPAVVARIAQLKDEYPALFAWEIQHQLCTEGLCTQDKAPS
VSSINRVLRALQEDQSLHWTQLRSPAVLAPVLPSPHSNCGAPRGPHPGTSHRNRTIFSPG
QAEALEKEFQRGQYPDSVARGKLAAATSLPEDTVRVWFSNRRAKWRRQEKLKWEAQLPGA
SQDLTVPKNSPGIISAQQSPGSVPSAALPVLEPLSPSFCQLCCGTAPGRCSSDTSSQAYL
QPYWDCQSLLPVASSSYVEFAWPCLTTHPVHHLIGGPGQVPSTHCSNWP
NT seq 1050 nt   +upstreamnt  +downstreamnt
atgcagcaggacggactcagcagtgtgaatcagctagggggactctttgtgaatggccgg
ccccttcctctggacaccaggcagcagattgtgcagctagcaataagagggatgcgaccc
tgtgacatttcacggagccttaaggtatctaatggctgtgtgagcaagatcctaggacgc
tactaccgcacaggtgtcttggaacccaagtgtattgggggaagcaaaccacgtctggcc
acacctgctgtggtggctcgaattgcccagctaaaggatgagtaccctgctctttttgcc
tgggagatccaacaccagctttgcactgaagggctttgtacccaggacaaggctcccagt
gtgtcctctatcaatcgagtacttcgggcacttcaggaagaccagagcttgcactggact
caactcagatcaccagctgtgttggctccagttcttcccagtccccacagtaactgtggg
gctccccgaggtccccacccaggaaccagccacaggaatcggactatcttctccccggga
caagccgaggcactggagaaagagtttcagcgtgggcagtatccagattcagtggcccgt
gggaagctggctgctgccacctctctgcctgaagacacggtgagggtttggttttctaac
agaagagccaaatggcgcaggcaagagaagctgaaatgggaagcacagctgccaggtgct
tcccaggacctgacagtaccaaaaaattctccagggatcatctctgcacagcagtccccc
ggcagtgtaccctcagctgccttgcctgtgctggaaccattgagtccttccttctgtcag
ctatgctgtgggacagcaccaggcagatgttccagtgacacctcatcccaggcctatctc
caaccctactgggactgccaatccctccttcctgtggcttcctcctcatatgtggaattt
gcctggccctgcctcaccacccatcctgtgcatcatctgattggaggcccaggacaagtg
ccatcaacccattgctcaaactggccataa

DBGET integrated database retrieval system