KEGG   Mus musculus (mouse): 18609
Entry
18609             CDS       T01002                                 

Gene name
Pdx1, IDX-, IDX-1, IPF, IPF-1, Ip, Ipf1, Mody, Mody4, STF-, STF-1, pdx-, pdx-1
Definition
(RefSeq) pancreatic and duodenal homeobox 1
  KO
K07594  insulin promoter factor 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04911  Insulin secretion
mmu04930  Type II diabetes mellitus
mmu04950  Maturity onset diabetes of the young
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    18609 (Pdx1)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    18609 (Pdx1)
   04950 Maturity onset diabetes of the young
    18609 (Pdx1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    18609 (Pdx1)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain ANTP: HOXL
    18609 (Pdx1)
SSDB
Motif
Pfam: Homeodomain
Other DBs
NCBI-GeneID: 18609
NCBI-ProteinID: NP_032840
MGI: 102851
Ensembl: ENSMUSG00000029644
Vega: OTTMUSG00000037552
UniProt: P52946
Position
5 G3; 5 86.84 cM
AA seq 284 aa
MNSEEQYYAATQLYKDPCAFQRGPVPEFSANPPACLYMGRQPPPPPPPQFTSSLGSLEQG
SPPDISPYEVPPLASDDPAGAHLHHHLPAQLGLAHPPPGPFPNGTEPGGLEEPNRVQLPF
PWMKSTKAHAWKGQWAGGAYTAEPEENKRTRTAYTRAQLLELEKEFLFNKYISRPRRVEL
AVMLNLTERHIKIWFQNRRMKWKKEEDKKRSSGTPSGGGGGEEPEQDCAVTSGEELLAVP
PLPPPGGAVPPGVPAAVREGLLPSGLSVSPQPSSIAPLRPQEPR
NT seq 855 nt   +upstreamnt  +downstreamnt
atgaacagtgaggagcagtactacgcggccacacagctctacaaggacccgtgcgcattc
cagaggggcccggtgccagagttcagcgctaacccccctgcgtgcctgtacatgggccgc
cagcccccacctccgccgccaccccagtttacaagctcgctgggatcactggagcaggga
agtcctccggacatctccccatacgaagtgcccccgctcgcctccgacgacccggctggc
gctcacctccaccaccaccttccagctcagctcgggctcgcccatccacctcccggacct
ttcccgaatggaaccgagcctgggggcctggaagagcccaaccgcgtccagctccctttc
ccgtggatgaaatccaccaaagctcacgcgtggaaaggccagtgggcaggaggtgcttac
acagcggaacccgaggaaaacaagaggacccgtactgcctacacccgggcgcagctgctg
gagctggagaaggaattcttatttaacaaatacatctcccggccccgccgggtggagctg
gcagtgatgttgaacttgaccgagagacacatcaaaatctggttccaaaaccgtcgcatg
aagtggaaaaaagaggaagataagaaacgtagtagcgggaccccgagtgggggcggtggg
ggcgaagagccggagcaagattgtgcggtgacctcgggcgaggagctgctggcagtgcca
ccgctgccacctcccggaggtgccgtgcccccaggcgtcccagctgcagtccgggagggc
ctactgccttcgggccttagcgtgtcgccacagccctccagcatcgcgccactgcgaccg
caggaaccccggtga

DBGET integrated database retrieval system