KEGG   Mus musculus (mouse): 18783
Entry
18783             CDS       T01002                                 

Symbol
Pla2g4a, Pla, Pla2g4, cP, cPL, cPLA2, cPLA2-alpha, cPLA2alpha
Name
(RefSeq) phospholipase A2, group IVA (cytosolic, calcium-dependent)
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00564  Glycerophospholipid metabolism
mmu00565  Ether lipid metabolism
mmu00590  Arachidonic acid metabolism
mmu00591  Linoleic acid metabolism
mmu00592  alpha-Linolenic acid metabolism
mmu01100  Metabolic pathways
mmu04010  MAPK signaling pathway
mmu04014  Ras signaling pathway
mmu04072  Phospholipase D signaling pathway
mmu04217  Necroptosis
mmu04270  Vascular smooth muscle contraction
mmu04370  VEGF signaling pathway
mmu04611  Platelet activation
mmu04664  Fc epsilon RI signaling pathway
mmu04666  Fc gamma R-mediated phagocytosis
mmu04724  Glutamatergic synapse
mmu04726  Serotonergic synapse
mmu04730  Long-term depression
mmu04750  Inflammatory mediator regulation of TRP channels
mmu04912  GnRH signaling pathway
mmu04913  Ovarian steroidogenesis
mmu04921  Oxytocin signaling pathway
mmu05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    18783 (Pla2g4a)
   00565 Ether lipid metabolism
    18783 (Pla2g4a)
   00590 Arachidonic acid metabolism
    18783 (Pla2g4a)
   00591 Linoleic acid metabolism
    18783 (Pla2g4a)
   00592 alpha-Linolenic acid metabolism
    18783 (Pla2g4a)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    18783 (Pla2g4a)
   04014 Ras signaling pathway
    18783 (Pla2g4a)
   04370 VEGF signaling pathway
    18783 (Pla2g4a)
   04072 Phospholipase D signaling pathway
    18783 (Pla2g4a)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    18783 (Pla2g4a)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    18783 (Pla2g4a)
   04664 Fc epsilon RI signaling pathway
    18783 (Pla2g4a)
   04666 Fc gamma R-mediated phagocytosis
    18783 (Pla2g4a)
  09152 Endocrine system
   04912 GnRH signaling pathway
    18783 (Pla2g4a)
   04913 Ovarian steroidogenesis
    18783 (Pla2g4a)
   04921 Oxytocin signaling pathway
    18783 (Pla2g4a)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    18783 (Pla2g4a)
  09156 Nervous system
   04724 Glutamatergic synapse
    18783 (Pla2g4a)
   04726 Serotonergic synapse
    18783 (Pla2g4a)
   04730 Long-term depression
    18783 (Pla2g4a)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    18783 (Pla2g4a)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    18783 (Pla2g4a)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     18783 (Pla2g4a)
SSDB
Motif
Pfam: PLA2_B C2
Other DBs
NCBI-GeneID: 18783
NCBI-ProteinID: NP_032895
MGI: 1195256
Ensembl: ENSMUSG00000056220
Vega: OTTMUSG00000016429
UniProt: P47713 Q3UMQ1
Position
1 G1; 1 63.51 cM
AA seq 748 aa
MSFIDPYQHIIVEHQYSHKFTVVVLRATKVTKGTFGDMLDTPDPYVELFISTTPDSRKRT
RHFNNDINPVWNETFEFILDPNQENVLEITLMDANYVMDETLGTATFPVSSMKVGEKKEV
PFIFNQVTEMILEMSLEVCSCPDLRFSMALCDQEKTFRQQRKENIKENMKKLLGPKKSEG
LYSTRDVPVVAILGSGGGFRAMVGFSGVMKALYESGILDCATYIAGLSGSTWYMSTLYSH
PDFPEKGPEEINEELMKNVSHNPLLLLTPQKVKRYVESLWKKKSSGQPVTFTDIFGMLIG
ETLIQNRMSMTLSSLKEKVNAARCPLPLFTCLHVKPDVSELMFADWVEFSPYEIGMAKYG
TFMAPDLFGSKFFMGTVVKKYEENPLHFLMGVWGSAFSILFNRVLGVSGSQNKGSTMEEE
LENITAKHIVSNDSSDSDDEAQGPKGTENEEAEKEYQSDNQASWVHRMLMALVSDSALFN
TREGRAGKVHNFMLGLNLNTSYPLSPLRDFSSQDSFDDELDAAVADPDEFERIYEPLDVK
SKKIHVVDSGLTFNLPYPLILRPQRGVDLIISFDFSARPSDTSPPFKELLLAEKWAKMNK
LPFPKIDPYVFDREGLKECYVFKPKNPDVEKDCPTIIHFVLANINFRKYKAPGVLRETKE
EKEIADFDIFDDPESPFSTFNFQYPNQAFKRLHDLMYFNTLNNIDVIKDAIVESIEYRRQ
NPSRCSVSLSNVEARKFFNKEFLSKPTV
NT seq 2247 nt   +upstreamnt  +downstreamnt
atgtctttcatagatccttatcagcacattatagtggaacaccagtactcccataagttt
actgttgtggttctacgtgccaccaaagtaaccaaggggacctttggcgatatgctggac
actccagatccttatgtggaacttttcatctctacaacccctgacagcaggaagcgaacg
agacacttcaataatgatataaaccccgtgtggaatgagacctttgagttcattttggat
cctaatcaggaaaatgttttggagatcacactgatggatgccaactacgtcatggatgaa
accctaggcacagctacattccctgtatcttcaatgaaagtgggagagaagaaagaagtc
ccttttattttcaaccaagtcactgaaatgattctggaaatgtctctggaagtttgttca
tgcccagacctacggttcagcatggcactgtgtgatcaggagaaaactttcagacagcag
aggaaagagaacataaaagagaacatgaagaaacttttgggtccaaaaaagagtgagggg
ctttattccacacgtgatgtgccggtggtggccattttgggttcaggtgggggtttccgg
gccatggtgggattctctggtgtgatgaaggcactgtatgagtcggggattttggactgt
gctacatacattgctggtctttctggatccacatggtacatgtcaaccttgtactctcac
cccgattttccagagaaaggtcccgaggagattaatgaagagctaatgaaaaatgtcagc
cacaaccctctcttacttcttacaccacagaaagttaaaagatacgttgagtctttatgg
aagaagaaaagttctggccagcctgtcacctttactgacatctttgggatgctaatagga
gaaacactaattcaaaataggatgagcatgaccctgagtagtttgaaggaaaaggtcaat
gccgcccggtgtcctttgcctctcttcacgtgtctccacgtcaaacctgatgtgtcagag
ctgatgtttgccgattgggtggaatttagtccatatgagattggcatggcaaaatatggt
acctttatggctcctgacctatttggaagcaagttttttatgggaacagttgtaaaaaaa
tatgaagaaaaccccttgcatttcttgatgggtgtctggggcagtgccttttctatactg
ttcaacagagttttgggagtttctggctcacagaataaaggctctacaatggaagaggaa
ttagaaaatattacagcaaagcacatcgtgagtaatgacagctccgacagtgatgatgag
gctcaaggacccaaaggcaccgagaatgaagaagctgaaaaagagtaccaaagcgacaac
caagcaagttgggtccatcggatgctaatggccttggtgagcgactcggctttattcaat
acccgagaaggacgtgccggaaaggtgcataacttcatgctgggcttgaatctcaacaca
tcatatccactgtctcccctgagagacttcagctctcaggattccttcgatgacgagctc
gacgcagcggtagcagatccagatgaatttgaacgaatatatgaaccactggatgtcaaa
agtaagaagattcatgtggtagatagtgggctcacatttaacctgccatatcccttgatt
cttcgacctcagagaggtgtggatcttatcatctcctttgacttttctgcaaggccgagt
gacaccagtccccctttcaaggaacttctgcttgcagagaagtgggcgaaaatgaacaag
cttccctttccaaagatcgatccttatgtgtttgatcgggaaggattaaaggaatgctat
gtttttaaacctaagaatcctgatgtggagaaggattgcccaaccattatccactttgtt
ctggccaacatcaacttcagaaagtacaaggccccaggtgttctaagggaaaccaaagaa
gagaaagaaattgctgactttgacatttttgatgaccccgaatcgccattttcaaccttc
aactttcagtatcccaatcaagcattcaaaaggcttcacgatttgatgtacttcaacaca
ctgaacaacattgatgtgataaaggatgccattgttgagagcattgaatacagaagacag
aacccatctcgttgctctgtttccctcagtaatgttgaagcaagaaaattcttcaataag
gagtttctaagtaaacccactgtgtaa

KEGG   Mus musculus (mouse): 211429
Entry
211429            CDS       T01002                                 

Symbol
Pla2g4b, A030011C02Rik, Gm1013, cPLA2-beta
Name
(RefSeq) phospholipase A2, group IVB (cytosolic)
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00564  Glycerophospholipid metabolism
mmu00565  Ether lipid metabolism
mmu00590  Arachidonic acid metabolism
mmu00591  Linoleic acid metabolism
mmu00592  alpha-Linolenic acid metabolism
mmu01100  Metabolic pathways
mmu04010  MAPK signaling pathway
mmu04014  Ras signaling pathway
mmu04072  Phospholipase D signaling pathway
mmu04217  Necroptosis
mmu04270  Vascular smooth muscle contraction
mmu04370  VEGF signaling pathway
mmu04611  Platelet activation
mmu04664  Fc epsilon RI signaling pathway
mmu04666  Fc gamma R-mediated phagocytosis
mmu04724  Glutamatergic synapse
mmu04726  Serotonergic synapse
mmu04730  Long-term depression
mmu04750  Inflammatory mediator regulation of TRP channels
mmu04912  GnRH signaling pathway
mmu04913  Ovarian steroidogenesis
mmu04921  Oxytocin signaling pathway
mmu05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    211429 (Pla2g4b)
   00565 Ether lipid metabolism
    211429 (Pla2g4b)
   00590 Arachidonic acid metabolism
    211429 (Pla2g4b)
   00591 Linoleic acid metabolism
    211429 (Pla2g4b)
   00592 alpha-Linolenic acid metabolism
    211429 (Pla2g4b)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    211429 (Pla2g4b)
   04014 Ras signaling pathway
    211429 (Pla2g4b)
   04370 VEGF signaling pathway
    211429 (Pla2g4b)
   04072 Phospholipase D signaling pathway
    211429 (Pla2g4b)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    211429 (Pla2g4b)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    211429 (Pla2g4b)
   04664 Fc epsilon RI signaling pathway
    211429 (Pla2g4b)
   04666 Fc gamma R-mediated phagocytosis
    211429 (Pla2g4b)
  09152 Endocrine system
   04912 GnRH signaling pathway
    211429 (Pla2g4b)
   04913 Ovarian steroidogenesis
    211429 (Pla2g4b)
   04921 Oxytocin signaling pathway
    211429 (Pla2g4b)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    211429 (Pla2g4b)
  09156 Nervous system
   04724 Glutamatergic synapse
    211429 (Pla2g4b)
   04726 Serotonergic synapse
    211429 (Pla2g4b)
   04730 Long-term depression
    211429 (Pla2g4b)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    211429 (Pla2g4b)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    211429 (Pla2g4b)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     211429 (Pla2g4b)
SSDB
Motif
Pfam: PLA2_B cPLA2_C2 C2
Other DBs
NCBI-GeneID: 211429
NCBI-ProteinID: NP_663353
MGI: 2384819
Ensembl: ENSMUSG00000098488
Vega: OTTMUSG00000015287
UniProt: P0C871 Q06G06 B7ZCM8
Position
2; 2 E5
AA seq 791 aa
MALQTCPVYMQAKVPETCLLTVRVLRASGLPSKDLVTSSDCYVTLNLPTASSHTLQTRTV
KNSRNPVWNQNFHFRIHRQLKNVMELKVFDHDLVTRDDPVLSVLFDVGTLQIGTQRQSFS
LGTQEKGCLEVEFRLQTLTDCEEQLISNGIVVARELSCLHVELKRTGDPKRSERKVQLVV
AGACEGPQDASAGTGSFHFHYPACWEQELNVHLQDDPHEQLKVPLRTLPSSQLVRLVFPT
SQEPLMRLELKKEEGPKELAVRLGCGPCPEEQAFLSKRKQVVAAALKKALQLDQDLHEDE
IPVIAVMATGGGIRAMTSLYGQLAGLQELGLLDCISYITGASGSTWALANLYEDPEWSQK
DLAGPTEVLKTQVTKSKLGALAPSQLWRYRQELAERARLGHPTCFTNLWALINEALLHDK
PHEHKLSDQREALSRGQNPLPIYCALNSKEQGLSTFDFGEWCEFSPYEVGFPKYGAFISS
ELFGSEFFMGRLVKQLPESRICFLEGIWSNLFAASLQDSLYWSSEPSQFWDRWAQDQANL
DKEQVPHLKIAEPPTMAGRIAELFTDLLTKRPLAHATHNFTRGLHFHKDYFQNSHFSAWK
ASKLDRLPNQLTPTEPHLCLLDVGYLINTSCPPLLQPTRDVDLILSLDYNLYGAFQQLQL
LSRFCQEQGIPFPSISPSPEEQRQPQECHLFCDPAQPEAPAVLHFPLVNDSFQDYSAPGV
PRTSEEKAAGEVNLSSSDSPYHYTKVTYSQEDVDKLLRLTHYNICNNQDRLREAMHQAVQ
RRRKRKQFRPE
NT seq 2376 nt   +upstreamnt  +downstreamnt
atggctctgcaaacctgcccagtctacatgcaggcaaaggtgccagagacatgcctgctc
actgtacgcgtcctccgggccagtggcttgccttccaaggacctagtaacctcctctgac
tgctatgtgactctgaacctgcccacggcttccagccacacgctccagacacgcacagtc
aagaacagccgaaaccctgtctggaatcagaacttccacttccggatccataggcagctc
aagaatgttatggaactgaaagtctttgaccatgacctggtgaccagagatgacccagta
ttgtcagtgctgtttgacgtggggaccctgcaaattgggactcagcgccagagcttctcc
ttgggtactcaggagaaagggtgcttagaagttgagtttcggctacagactctgacagac
tgtgaggaacagctcatcagcaatggcatcgtggtggcccgggaactctcctgcttgcac
gttgaactgaagaggacaggagatccaaagaggtcagagcgcaaagttcaacttgtggtt
gctggggcctgtgagggcccacaggatgcctctgcgggcactggatctttccacttccat
tatccagcctgctgggagcaagagctgaatgttcatctgcaggatgacccccatgagcag
ctgaaggtgccactacgaactctaccctcctcgcagctggtgagacttgtcttccccacg
tcccaggagccactgatgaggctggaactcaagaaggaagaaggaccaaaggagctggct
gtgcggctgggctgtgggccctgccctgaggaacaggccttcctaagcaagaggaagcag
gtggtggctgccgcgctgaaaaaggccttacagctggaccaagacctgcacgaggatgag
atccccgtgattgccgtgatggccactggtggtgggatccgggccatgacgtctttgtat
gggcagctggccggcctgcaggagctcggccttctcgactgcatctcctatatcacgggg
gcttcaggatccacctgggcactggccaacctctatgaggacccagagtggtcgcagaag
gacctggcagggcccactgaggtgctgaagacacaggtgacaaagagcaagctgggtgcg
ttggcccctagccaactttggcggtaccggcaagagctggctgagcgtgctcgcctgggc
cacccaacctgcttcaccaacttgtgggccctcattaatgaggccttgctgcacgacaag
ccccatgaacacaaactctcagatcaacgagaggccctgagtcgaggccagaaccctctg
cctatctattgtgccctcaacagcaaggagcagggcctgagtacctttgactttggggag
tggtgtgagttctctccatatgaagtcggcttccccaagtatggagccttcatctcctcc
gagctctttggctcggagttctttatggggcggctggtgaagcagcttcccgagtcccgc
atctgcttcctggaaggcatctggagcaatctgtttgcggccagcctccaagacagcttg
tactggtcctcagaacccagccagttctgggaccgctgggcgcaggatcaggccaacctg
gacaaagagcaggtcccccatctgaagatagcagagccaccgacaatggctggcaggatc
gccgagctcttcactgacctcctgacaaagcgtcccctcgcccacgccacccacaacttc
acgcgaggcctccatttccacaaggactatttccagaactctcacttctctgcctggaaa
gcttccaaactggacaggctccccaaccagctgacacccactgagccccacctctgcctc
ctggatgttggctatctcatcaatactagctgcccacccctcctgcagccaacacgggat
gtggacctcatcttgtcactggactacaacctctacggagcctttcagcagctgcagctt
ctgagccggttctgccaggagcagggcatccctttcccatccatctcacccagccccgag
gagcagcggcagcctcaggagtgccatctgttctgtgacccagcccagcccgaagccccg
gctgtgctgcacttccctttggtcaatgactccttccaagactactctgcccctggggtg
ccacggacatcggaggagaaggcagctggggaggtgaatctgtcttcttctgactcccca
taccactacacaaaagtgacctacagccaggaagatgtggacaagctgttacggctgacg
cattacaacatctgcaacaaccaggatcggctgcgggaggccatgcaccaggccgtgcag
cggcggagaaagcgcaaacagtttaggccggagtga

KEGG   Mus musculus (mouse): 232889
Entry
232889            CDS       T01002                                 

Symbol
Pla2g4c, CPLA2-, D7Ertd445e
Name
(RefSeq) phospholipase A2, group IVC (cytosolic, calcium-independent)
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00564  Glycerophospholipid metabolism
mmu00565  Ether lipid metabolism
mmu00590  Arachidonic acid metabolism
mmu00591  Linoleic acid metabolism
mmu00592  alpha-Linolenic acid metabolism
mmu01100  Metabolic pathways
mmu04010  MAPK signaling pathway
mmu04014  Ras signaling pathway
mmu04072  Phospholipase D signaling pathway
mmu04217  Necroptosis
mmu04270  Vascular smooth muscle contraction
mmu04370  VEGF signaling pathway
mmu04611  Platelet activation
mmu04664  Fc epsilon RI signaling pathway
mmu04666  Fc gamma R-mediated phagocytosis
mmu04724  Glutamatergic synapse
mmu04726  Serotonergic synapse
mmu04730  Long-term depression
mmu04750  Inflammatory mediator regulation of TRP channels
mmu04912  GnRH signaling pathway
mmu04913  Ovarian steroidogenesis
mmu04921  Oxytocin signaling pathway
mmu05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    232889 (Pla2g4c)
   00565 Ether lipid metabolism
    232889 (Pla2g4c)
   00590 Arachidonic acid metabolism
    232889 (Pla2g4c)
   00591 Linoleic acid metabolism
    232889 (Pla2g4c)
   00592 alpha-Linolenic acid metabolism
    232889 (Pla2g4c)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    232889 (Pla2g4c)
   04014 Ras signaling pathway
    232889 (Pla2g4c)
   04370 VEGF signaling pathway
    232889 (Pla2g4c)
   04072 Phospholipase D signaling pathway
    232889 (Pla2g4c)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    232889 (Pla2g4c)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    232889 (Pla2g4c)
   04664 Fc epsilon RI signaling pathway
    232889 (Pla2g4c)
   04666 Fc gamma R-mediated phagocytosis
    232889 (Pla2g4c)
  09152 Endocrine system
   04912 GnRH signaling pathway
    232889 (Pla2g4c)
   04913 Ovarian steroidogenesis
    232889 (Pla2g4c)
   04921 Oxytocin signaling pathway
    232889 (Pla2g4c)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    232889 (Pla2g4c)
  09156 Nervous system
   04724 Glutamatergic synapse
    232889 (Pla2g4c)
   04726 Serotonergic synapse
    232889 (Pla2g4c)
   04730 Long-term depression
    232889 (Pla2g4c)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    232889 (Pla2g4c)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    232889 (Pla2g4c)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     232889 (Pla2g4c)
SSDB
Motif
Pfam: PLA2_B CvfB_WH Gcn1_N DUF1116
Other DBs
NCBI-GeneID: 232889
NCBI-ProteinID: NP_001004762
MGI: 1196403
Ensembl: ENSMUSG00000033847
Vega: OTTMUSG00000036437
UniProt: Q64GA5
Position
7 A1; 7 7.84 cM
AA seq 597 aa
MELSSGVCPATRLQEAEKAAVHKRSPKVLEALRKLNIQADQAPVIAVLGSGGGLRAHIAC
LGVLSELKELGLLDAVTYLAGVSGSTWALSSLYTKNGNMEGIEEELKHRYEKNEWDFHES
LEKAIQASKRENYSLTDFWAYLIVSRQIRELQDSNLSSLKKQVEEGVLPYPIFAAIDEDL
LADWRERKTQNSWFEFTPHHAGYPALGAYVPITEFGSRFENGKLVKSEPERDLTFLRGLW
GSAFADIKEIKNYILNYFRNPFGKLKFIEGPVTYSEAPRMNVDAMLLDLVMAYFTDMNDP
SIKDKLCALQQALGTETDEFGIEMAEIIQNWNETSAEKKEQFLDHLLDRFKKTQEDTTTY
SLMNWNTGLVWDRCVFVNETRKCVSKWQWGTVYNFLYKHGKIADETMCSRELLHLVDAGF
AINTPYPLVLPPVRETHLILSFDFSAGDPLETIRATADYCQRHEIPFPEVSEDQLKEWAK
APASCYVLRGETGPVVMHFTLFNKDNCGDDIETWRKKYGTVKLSDSYTPDLVRDLLRVSK
ENVKKNKINILSEMRKVAGNPGNIPRVNKEACLGDRVKDPQGSQTVEFKKSHNISKD
NT seq 1794 nt   +upstreamnt  +downstreamnt
atggaactaagctctggggtctgccctgccactagactccaggaagcagaaaaggcagct
gtgcacaaacgcagtcccaaggttttggaggctctacgaaagctcaacatccaagctgac
caggctccagtcattgctgtcttgggctctggcggggggctgcgggcccacatcgcttgt
cttggtgtgctgagtgagctgaaagaacttggcctgttggatgctgtcacatacctcgca
ggggtctctgggtccacttgggcactgtcttcactctacaccaagaatggaaatatggaa
gggatagaagaggagctgaaacatcggtatgagaagaatgagtgggactttcatgagagc
ctggagaaagccatccaggcatcaaagagggagaattactccctgactgacttttgggcc
tatttaattgtttccaggcaaatcagagaacttcaggattcgaatttgtccagtctaaag
aagcaagtggaagaaggagtgctgccctatcccatctttgcagccattgatgaggacctt
ctggctgattggagggagaggaaaactcagaattcctggtttgaattcactcctcatcat
gctggctaccctgcacttggggcttatgtccccatcacagagtttggaagcagatttgag
aatgggaaactggttaaatctgagcctgagagagatttgactttcctgagaggtttatgg
ggaagtgcttttgctgatattaaagaaattaagaattatattttgaactacttcaggaac
ccctttggaaaattgaagtttatagaaggaccagtgacatactcagaagcaccaaggatg
aatgtggatgcaatgctcttggatttagtgatggcttatttcacagatatgaatgacccc
agcatcaaggataagctctgtgcccttcagcaggctctgggtactgagacagatgaattt
ggcatagagatggctgagatcatccagaattggaatgagacctccgcagagaagaaggag
cagtttctcgaccatctgttggatcgcttcaagaagacacaagaagacaccaccacatac
agtttgatgaactggaacacgggtctagtttgggaccgttgcgtttttgtgaatgaaact
cgcaagtgtgtctccaaatggcagtggggaactgtttacaacttcctctataaacacggt
aaaattgcagatgagaccatgtgcagccgagagcttctccatctggtggatgctggtttt
gccatcaacactccctatccacttgttctgcctcctgtgcgtgaaactcacctcatcctc
tcatttgacttcagtgctggggacccactagagaccatcagggccacagcagactactgc
caacgccatgaaatcccctttcctgaggtgagcgaggatcagctgaaggaatgggccaaa
gccccagcaagctgctatgtcctcagaggggaaacaggacctgttgtcatgcactttact
ctgttcaacaaagacaactgtggagatgatattgagacatggagaaaaaaatatgggaca
gtaaaactatctgactcatacacaccagacctggtgagagatttgctgagggtatccaag
gagaatgtgaagaaaaacaaaattaatatcctcagtgagatgaggaaagtggctgggaat
cctgggaacatcccaagagtgaacaaggaggcctgcttgggagacagagtgaaggatccc
caaggctctcagactgtggagtttaagaaatcccacaacatatctaaggattaa

KEGG   Mus musculus (mouse): 271844
Entry
271844            CDS       T01002                                 

Symbol
Pla2g4f, 4732472I07Rik, Gm647, Pla2, Pla2zeta
Name
(RefSeq) phospholipase A2, group IVF
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00564  Glycerophospholipid metabolism
mmu00565  Ether lipid metabolism
mmu00590  Arachidonic acid metabolism
mmu00591  Linoleic acid metabolism
mmu00592  alpha-Linolenic acid metabolism
mmu01100  Metabolic pathways
mmu04010  MAPK signaling pathway
mmu04014  Ras signaling pathway
mmu04072  Phospholipase D signaling pathway
mmu04217  Necroptosis
mmu04270  Vascular smooth muscle contraction
mmu04370  VEGF signaling pathway
mmu04611  Platelet activation
mmu04664  Fc epsilon RI signaling pathway
mmu04666  Fc gamma R-mediated phagocytosis
mmu04724  Glutamatergic synapse
mmu04726  Serotonergic synapse
mmu04730  Long-term depression
mmu04750  Inflammatory mediator regulation of TRP channels
mmu04912  GnRH signaling pathway
mmu04913  Ovarian steroidogenesis
mmu04921  Oxytocin signaling pathway
mmu05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    271844 (Pla2g4f)
   00565 Ether lipid metabolism
    271844 (Pla2g4f)
   00590 Arachidonic acid metabolism
    271844 (Pla2g4f)
   00591 Linoleic acid metabolism
    271844 (Pla2g4f)
   00592 alpha-Linolenic acid metabolism
    271844 (Pla2g4f)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    271844 (Pla2g4f)
   04014 Ras signaling pathway
    271844 (Pla2g4f)
   04370 VEGF signaling pathway
    271844 (Pla2g4f)
   04072 Phospholipase D signaling pathway
    271844 (Pla2g4f)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    271844 (Pla2g4f)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    271844 (Pla2g4f)
   04664 Fc epsilon RI signaling pathway
    271844 (Pla2g4f)
   04666 Fc gamma R-mediated phagocytosis
    271844 (Pla2g4f)
  09152 Endocrine system
   04912 GnRH signaling pathway
    271844 (Pla2g4f)
   04913 Ovarian steroidogenesis
    271844 (Pla2g4f)
   04921 Oxytocin signaling pathway
    271844 (Pla2g4f)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    271844 (Pla2g4f)
  09156 Nervous system
   04724 Glutamatergic synapse
    271844 (Pla2g4f)
   04726 Serotonergic synapse
    271844 (Pla2g4f)
   04730 Long-term depression
    271844 (Pla2g4f)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    271844 (Pla2g4f)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    271844 (Pla2g4f)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     271844 (Pla2g4f)
SSDB
Motif
Pfam: PLA2_B cPLA2_C2 C2 Patatin
Other DBs
NCBI-GeneID: 271844
NCBI-ProteinID: NP_001019316
MGI: 2685493
Ensembl: ENSMUSG00000046971
Vega: OTTMUSG00000015278
UniProt: Q50L41
Position
2; 2 E5
AA seq 855 aa
MPWTLQPKWLAGKGLPLLGAILLRKTEKSEPQWKHRRQETHPYYDLQVKVLRARNIQHTD
KLSKADCYVRLWLPTASVSPSQTRTVVNSSDPEWNETFPYQIHGAVKNVLELALYDEDVL
DSDNVFSILFDTSTLQLGQPCTKNFTRQQDPKELEVEFTLEKSQTPASEVVTNGVLVAHP
CLRIQGTVTGDKTASLGELGSRQIQLAVPGAYEKPQPLQPTSEPGLPVNFTFHVNPVLSP
KLHIKLQEQLQVFHSGPSDELEAQTSKMDKASILLSSLPLNEELTKLVDLEEGQQVSLRM
KADMSSSGDLDLRLGFDLCDGEQEFLDKRKQVASKALQRVMGLSEALHCDQVPVVAVLGS
GGGTRAMTSLYGSLAGLQELGLLDAVTYLSGVSGSSWCISTLYRDPSWSQKALQGPIKYA
SERVCSSKIGMLSPKQFEYYSREKRAWESRGHSMSFTDLWGLIIEYFLNQEENPAKLSDQ
QETVSQGQNPYPIYASINVHKNISGDDFAEWCEFTPYEVGFPKYGAYVPTELFGSEFFMG
RLLHFWPEPRICYLQGMWGSAFAASLYEIFLKLGGLSLSFLDWHRGSVSVTDDWPKLRKQ
DPTRLPTRLFTPMSSFSQAVLDIFTSRITCAQTFNFTRGLCMYKDYTARKDFVVSEDAWH
SHNYGYPDACPNQLTPMKDFLSLVDGGFAINSPFPLVLQPQRAVDLIVSFDYSLEGPFEV
LQVTEKYCRDRGIPFPRIEVDPKDSEDPRECYLFAEAEDPCSPIVLHFPLVNRTFRTHLA
PGVERQTAEEKAFGDFIINGPDTAYGMMDFTYEPKEFDRLVTLSRYNVLNNKETIRHALQ
LALDRRRQAGGRVGG
NT seq 2568 nt   +upstreamnt  +downstreamnt
atgccctggactctccagccaaagtggctggcaggcaagggacttccccttcttggagcc
atactgctacggaagacagaaaagagcgaaccacaatggaagcataggcggcaggaaacc
cacccatactacgaccttcaagtgaaggtgctgagggccagaaacatccagcacacagat
aagttgtccaaagccgactgctatgttcgactgtggctgcccacggcttctgttagcccc
agtcagacaaggacagtggttaacagcagtgatccagaatggaatgagacctttccctat
cagatccacggcgctgtgaagaacgtcctggagcttgccctttatgacgaggatgtcctg
gacagtgacaatgtcttctccattctgtttgacacgagtactcttcagctaggccagcct
tgcacaaaaaacttcaccaggcagcaggatccaaaagagctggaagtagaatttactctg
gaaaagagtcagacgcctgcatctgaagttgtcaccaatggtgtcctggtggctcacccc
tgtctgagaattcagggcacagtcactggagacaagacagcctcccttggagagttgggc
tccaggcagatccagctggcagtgcctggggcctatgaaaagccacagcctctgcagcca
acctcggagccaggcctcccagtgaactttaccttccacgtgaacccagtgctgagcccc
aagctgcacataaagctgcaagaacagctccaagtcttccatagtggcccgagtgatgag
ctggaagctcagaccagcaagatggacaaggcaagcatcctgctctcctctctgcccctc
aacgaggagttaacgaaacttgtggacctggaggagggccagcaggtgtctcttaggatg
aaggcagacatgagcagctctggggacttggacctgcgccttggttttgacctctgtgat
ggagagcaggaatttctggacaagaggaagcaggtggcgtccaaggccctgcagcgggtg
atgggattgagtgaggctctgcactgtgaccaggtacctgtggtagccgtgttaggctct
gggggtggaaccagagccatgacttccctgtacggcagcctggctgggctgcaggagctt
ggtcttctggatgccgtgacctacctgagtggggtctctgggtcttcctggtgcatctct
acactctacagggatccatcctggtcccagaaggctttgcagggccccattaaatatgcc
tcagagcgagtctgcagcagtaaaattgggatgctgtccccaaagcagtttgaatactac
tcccgggaaaagagagcctgggagagcaggggacacagcatgtccttcactgacttgtgg
ggcctcatcattgagtatttcctgaaccaggaggaaaaccctgccaagctgtcagaccag
caagaaacggtcagccagggtcagaacccataccccatctatgccagcattaatgtccac
aaaaacatcagtggggacgactttgcagagtggtgcgagttcaccccctatgaggtcggt
ttccccaagtacggggcttacgttcccacggaactctttggctctgaattcttcatgggc
cggctgctgcatttctggccagagccccgcatctgttacctgcagggtatgtggggaagt
gcttttgcagccagcctgtatgagatcttcctgaagctgggaggcctaagcctgagcttt
ctggactggcacagggggagtgtcagtgtcacagatgactggccaaagttacggaagcag
gaccccacacggctgcctaccagactcttcacgccaatgagttccttctctcaggctgtg
ctggacatattcacctcccgtattacttgtgcccagacctttaactttacccgaggtctc
tgcatgtacaaagactacacagctagaaaggacttcgtggtctctgaagatgcatggcat
tcacataactatggataccctgatgcctgtcccaaccagctcacacccatgaaggacttc
ctgtccctagtagatggaggctttgctatcaactcgccatttccactggtcctgcagccg
cagcgggctgtggacctcattgtgtcctttgactattccttggaaggcccttttgaggtc
ctgcaggtgacagagaagtactgccgggaccgagggatccccttcccaaggattgaggtg
gaccccaaggactctgaagacccccgtgaatgctatctgtttgctgaggcagaggacccc
tgctcgcccatcgtgctgcatttccctcttgtcaacaggacctttcgcacgcacctggcc
ccaggtgtggaacgacaaacagctgaggagaaggccttcggggactttatcatcaacggg
ccagatactgcctatggcatgatggatttcacctacgagcccaaggaatttgatcggctg
gtgaccctgagccgatacaacgtcttgaacaacaaggagactatcaggcatgccctccag
ctggctctggaccggcggcggcaggctgggggaagggttgggggctga

KEGG   Mus musculus (mouse): 329502
Entry
329502            CDS       T01002                                 

Symbol
Pla2g4e, 2310026J01Rik, C230096D22, Pl, Pla2epsilon
Name
(RefSeq) phospholipase A2, group IVE
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00564  Glycerophospholipid metabolism
mmu00565  Ether lipid metabolism
mmu00590  Arachidonic acid metabolism
mmu00591  Linoleic acid metabolism
mmu00592  alpha-Linolenic acid metabolism
mmu01100  Metabolic pathways
mmu04010  MAPK signaling pathway
mmu04014  Ras signaling pathway
mmu04072  Phospholipase D signaling pathway
mmu04217  Necroptosis
mmu04270  Vascular smooth muscle contraction
mmu04370  VEGF signaling pathway
mmu04611  Platelet activation
mmu04664  Fc epsilon RI signaling pathway
mmu04666  Fc gamma R-mediated phagocytosis
mmu04724  Glutamatergic synapse
mmu04726  Serotonergic synapse
mmu04730  Long-term depression
mmu04750  Inflammatory mediator regulation of TRP channels
mmu04912  GnRH signaling pathway
mmu04913  Ovarian steroidogenesis
mmu04921  Oxytocin signaling pathway
mmu05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    329502 (Pla2g4e)
   00565 Ether lipid metabolism
    329502 (Pla2g4e)
   00590 Arachidonic acid metabolism
    329502 (Pla2g4e)
   00591 Linoleic acid metabolism
    329502 (Pla2g4e)
   00592 alpha-Linolenic acid metabolism
    329502 (Pla2g4e)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    329502 (Pla2g4e)
   04014 Ras signaling pathway
    329502 (Pla2g4e)
   04370 VEGF signaling pathway
    329502 (Pla2g4e)
   04072 Phospholipase D signaling pathway
    329502 (Pla2g4e)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    329502 (Pla2g4e)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    329502 (Pla2g4e)
   04664 Fc epsilon RI signaling pathway
    329502 (Pla2g4e)
   04666 Fc gamma R-mediated phagocytosis
    329502 (Pla2g4e)
  09152 Endocrine system
   04912 GnRH signaling pathway
    329502 (Pla2g4e)
   04913 Ovarian steroidogenesis
    329502 (Pla2g4e)
   04921 Oxytocin signaling pathway
    329502 (Pla2g4e)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    329502 (Pla2g4e)
  09156 Nervous system
   04724 Glutamatergic synapse
    329502 (Pla2g4e)
   04726 Serotonergic synapse
    329502 (Pla2g4e)
   04730 Long-term depression
    329502 (Pla2g4e)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    329502 (Pla2g4e)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    329502 (Pla2g4e)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     329502 (Pla2g4e)
SSDB
Motif
Pfam: PLA2_B cPLA2_C2 C2
Other DBs
NCBI-GeneID: 329502
NCBI-ProteinID: NP_808513
MGI: 1919144
Ensembl: ENSMUSG00000050211
Vega: OTTMUSG00000015277
UniProt: Q50L42
Position
2; 2 E5
AA seq 875 aa
MQSIPHSDEADVAGMTHASEGHHGLGTSMLVPKNPQGEEDSKLGRNCSGFEDAQDPQTAV
PSSPLLSMASCSSQEGSSPCHLLTVRIIGMKNVRQADILSQTDCFVTLWLPTASQKKLKT
RTISNCLHPEWDESFTFQIQTQVKNVLELSVCDEDTLTQNDHLLTVLYDLSKLCLRNKTH
VKFPLNPEGMEELEVEFLLEENFSSSETLITNGVLVSRQVSCLEVHAESRRPRKRKKNKD
LLVMVTDSFENTQRVPPCQEPCYPNSACFHYPKYSQPQLYAEAPKSHCNFRLCCCGTHRN
DPVCQPLNCLSDGQVTTLPVGENYELHMKSSPCSDTLDVRLGFSLCQEEVEFVQKRKMVV
AKTLSQMLQLEEGLHEDEVPIIAIMATGGGTRSMVSLYGHLLGLQKLNFLDASTYITGLS
GATWTMATLYSDPEWSSKNLETVVFEARRHVVKDKMPALFPDQLYKWREDLQKHSQEGYK
TTFTDFWGKLIEYSLGDKKNECKLSDQRAALCRGQNPLPIYLTINVKDDVSNQDFREWFE
FSPYEVGMQKYGAFIPSELFGSEFFMGRLMKRIPEPEMCYMLGLWSSIFSLNLLDAWNLS
HTSEEFFYRWTRERLHDIEDDPILPEIPRCDDNPLETTVVIPTTWLSNTFREILTRRPFV
SEFHNFLYGMQLHTDYLQNRQFSMWKDTVLDTFPNQLTQFAKHLNLLDTAFFVNSSYAPL
LRPERKVDLIIHLNYCAGSQTKPLKQTCEYCTEQKIPFPSFSILEDDNSLKECYVMENPQ
EPDAPIVAYFPLISDTFQKYKAPGVERSPDELELGQLNIYGPKSPYATKELTYTEAAFDK
LVKLSEYNILNNRDKLIQALRLAMEKKRMRSQCPS
NT seq 2628 nt   +upstreamnt  +downstreamnt
atgcagtctattccacactccgatgaagcagacgtggctgggatgacccacgcctcagaa
ggccaccatggcctggggaccagcatgcttgtcccaaagaacccacaaggggaagaagac
agcaagctaggaagaaactgcagtggatttgaagatgcacaggacccacagactgctgtg
ccctcctcacctttactttccatggcttcttgcagttctcaggaggggtcatctccatgc
catctgttgacagtgaggatcattggcatgaaaaacgtccggcaggctgatatactgagt
cagacagactgctttgtgaccctctggctgcctactgcctctcagaagaagctgaagacc
agaaccatctccaactgcctacacccagagtgggacgaaagcttcacctttcagatccag
actcaagtaaagaatgtgctagagctgagcgtctgtgacgaagacaccctgacacaaaat
gaccatctcttgacagtcctctatgacctctctaagctttgcctccggaataaaacccat
gtgaagttcccactcaacccagagggcatggaagaactggaggtggagttcctactcgaa
gagaatttctcctcatcagagaccctcatcaccaacggcgtgctggtgtctcgccaagtc
tcttgcctggaggttcatgcagaatccaggaggccgaggaagaggaagaaaaacaaagac
cttctggtgatggtgacagactccttcgagaacacccagcgtgtcccgccttgccaggag
ccctgctaccccaattctgcctgcttccactaccccaagtactcccagccacagctttac
gcagaggcgcctaagagccactgtaactttaggctttgctgctgcggaacacacaggaat
gaccctgtctgccagcccctcaattgcctttctgatggccaggtgacaaccctgcctgtg
ggagagaactatgagctacacatgaagtcctcaccctgctctgacacactggatgtgcgg
cttggattcagcctgtgccaggaagaggtggagtttgtgcagaagcggaagatggtggtg
gccaagacactaagtcagatgctgcagctggaggaaggcctgcatgaggatgaggtaccg
ataatagccatcatggccacaggaggtggcacaaggtctatggtctccttgtatggccac
ctgctggggttgcagaagctgaactttctggacgcttctacttacatcaccggcttgtca
ggtgcaacctggactatggctaccttgtacagtgatcctgagtggtcctccaaaaacctg
gagactgttgtctttgaggcccggagacatgttgtcaaagacaagatgcctgccctgttc
ccagatcagctctacaaatggcgagaggacctccaaaagcatagccaggagggctataag
accacgtttacagacttttggggcaagctgatcgagtacagtctgggagataaaaaaaac
gaatgcaagctgtcagatcagcgagctgctctgtgcaggggacagaaccctctgcccatc
tacctcaccatcaatgtcaaggatgatgtaagcaaccaggatttcagagaatggttcgag
ttctccccctacgaggtgggcatgcagaagtacggagccttcatccccagcgagttattt
ggctccgagttcttcatggggcggctgatgaagaggattcctgagccggagatgtgctac
atgctagggttgtggagtagcatcttttccctgaacctgcttgatgcctggaatttgtct
cacacctcagaggagtttttctataggtggacaagggagagactgcatgacatcgaagat
gatcccatcctgcctgaaatccctaggtgtgacgataaccccctagagaccacagtagtg
atcccaacgacatggctgtccaacaccttccgagaaatcctcacacgcaggcccttcgtg
tctgagttccacaacttcctgtacgggatgcagctgcatactgactacttacagaacagg
cagttctctatgtggaaagacacagtactggacaccttcccaaaccagctgacacagttt
gcaaaacacctgaacctgctggacactgcgttctttgtcaactccagctacgcacccctc
cttaggccagagagaaaagtcgaccttatcatccacctcaattactgcgcaggatcccag
acaaagcccctgaaacaaacctgtgagtactgtaccgagcagaagatccccttccccagc
ttctccatcctggaagatgacaacagtctcaaggagtgctacgtgatggagaatccccag
gagcccgacgcccccatcgtggcttacttcccactcatcagtgacaccttccagaagtac
aaggctccaggtgtagagcgaagtcctgacgagctggaactgggccagctgaacatctat
ggaccaaagtctccctatgccaccaaggagctgacgtacacagaggccgccttcgacaag
ctggtgaagctctcagaatataatatcctcaataacagagataagctcattcaggccttg
agactagcaatggagaagaaacgcatgaggagccagtgtccctcctag

KEGG   Mus musculus (mouse): 78390
Entry
78390             CDS       T01002                                 

Symbol
Pla2g4d, 2610311B01Rik, Pla2, Pla2delta, cPLA2delta
Name
(RefSeq) phospholipase A2, group IVD
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00564  Glycerophospholipid metabolism
mmu00565  Ether lipid metabolism
mmu00590  Arachidonic acid metabolism
mmu00591  Linoleic acid metabolism
mmu00592  alpha-Linolenic acid metabolism
mmu01100  Metabolic pathways
mmu04010  MAPK signaling pathway
mmu04014  Ras signaling pathway
mmu04072  Phospholipase D signaling pathway
mmu04217  Necroptosis
mmu04270  Vascular smooth muscle contraction
mmu04370  VEGF signaling pathway
mmu04611  Platelet activation
mmu04664  Fc epsilon RI signaling pathway
mmu04666  Fc gamma R-mediated phagocytosis
mmu04724  Glutamatergic synapse
mmu04726  Serotonergic synapse
mmu04730  Long-term depression
mmu04750  Inflammatory mediator regulation of TRP channels
mmu04912  GnRH signaling pathway
mmu04913  Ovarian steroidogenesis
mmu04921  Oxytocin signaling pathway
mmu05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    78390 (Pla2g4d)
   00565 Ether lipid metabolism
    78390 (Pla2g4d)
   00590 Arachidonic acid metabolism
    78390 (Pla2g4d)
   00591 Linoleic acid metabolism
    78390 (Pla2g4d)
   00592 alpha-Linolenic acid metabolism
    78390 (Pla2g4d)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    78390 (Pla2g4d)
   04014 Ras signaling pathway
    78390 (Pla2g4d)
   04370 VEGF signaling pathway
    78390 (Pla2g4d)
   04072 Phospholipase D signaling pathway
    78390 (Pla2g4d)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    78390 (Pla2g4d)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    78390 (Pla2g4d)
   04664 Fc epsilon RI signaling pathway
    78390 (Pla2g4d)
   04666 Fc gamma R-mediated phagocytosis
    78390 (Pla2g4d)
  09152 Endocrine system
   04912 GnRH signaling pathway
    78390 (Pla2g4d)
   04913 Ovarian steroidogenesis
    78390 (Pla2g4d)
   04921 Oxytocin signaling pathway
    78390 (Pla2g4d)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    78390 (Pla2g4d)
  09156 Nervous system
   04724 Glutamatergic synapse
    78390 (Pla2g4d)
   04726 Serotonergic synapse
    78390 (Pla2g4d)
   04730 Long-term depression
    78390 (Pla2g4d)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    78390 (Pla2g4d)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    78390 (Pla2g4d)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     78390 (Pla2g4d)
SSDB
Motif
Pfam: PLA2_B cPLA2_C2 C2
Other DBs
NCBI-GeneID: 78390
NCBI-ProteinID: NP_001019308
MGI: 1925640
Ensembl: ENSMUSG00000070719
Vega: OTTMUSG00000015285
UniProt: Q50L43
Position
2; 2 E5
AA seq 825 aa
MWSGDRRVGMESLSPERLHGHPYQEEASVFCRLTVKILEARSLPRADLLSQADPYVTVQL
PTASGMKFKTQTVTNSSHPVWNETFSFLIQSQVKNILELTIYDEDVITKDDICFKVSYDV
SEILPGQLLQKTFSLNPQGPEELDVELLMERTWDPPENLITNNVLVARELSHLDVSLDRA
GNTAMAAGQDKLELELMLKGSYEDTQTFFPDTAFTFSFHYMRGQDTELNGYLRGPRNSGW
NSDTSVTPFNVPLMSLAAGKEMTIDIPAMKAPEGKLQLKTDCCPKELSVRLSYGLCPEEQ
AFLSRRKKVVAAALKQALQLDEDLNEDEVPVVGINAEGGGMRAMISLYGHLLALQKLGLL
DCVTYFSGISGSTWTMAHLYRDPEWSQRDLEGPISHAREHVAKTLLKEFLPEHLASYRQT
LKLREEQGYTVTVADLWGLVLESKLHGQVTDQKLSGQRAALERGQNPLPLYLSLNVKENH
LETLHFKEWVEFSPYEVGFLKYGGFVPSELFGSEFFMGRLMKRLPESQICFLEGIWSNLF
SVNLMDIWYDITYGKDSNNFPVDVRNSEKEFSGSAGTSSGVEAPWLESGTALAQALKGFL
TGRPFHQRSANFLHGLQLHRDYCNQRHFSTWADCNLDDTPNQLTPQDPQLCLIDAGCFMN
SSCPSLFRPGRQVDLIISFNYNQSLPFKGLQQSEKYSRARGLPFPRVEPSPEDHSQPQEC
YLFSDPTCPEAPVVLHFPLVNDSFRDHSAPGVRRSPDELKAGQVNLTGAASPYFMYNMTY
KNEDFDRLLQLSDYNVQNNQGTILQALRTVLKRRASETRPLGVKT
NT seq 2478 nt   +upstreamnt  +downstreamnt
atgtggagtggagatagaagagtaggcatggagagcctgtcacccgagagactacatggc
catccttaccaggaggaggcctctgtcttctgccggctcactgtgaaaatcctggaggct
cggagtctgcccagggctgacctgttgagtcaggcagatccctatgtgactgtgcagctg
ccaacagcttctggaatgaaattcaagacccaaacagtcactaactccagtcatcctgtg
tggaacgagaccttcagtttcctcatccagagtcaggtcaagaacattctagaactaact
atctatgacgaagacgtaattacgaaagatgacatctgcttcaaggtttcttatgatgtc
tcagaaatccttcctggacagctgctccagaaaaccttcagcctgaatcctcagggacca
gaagagttagatgtggagctcctaatggaaagaacgtgggaccctccagaaaacctcatc
accaacaatgttcttgtggcccgagaactgtcacacctggatgtctccctggacagagcc
gggaacaccgccatggcagcaggccaggacaaactagagctggagcttatgctgaagggg
tcatatgaggacacacagacatttttcccggacacagcttttaccttcagcttccactac
atgaggggccaagacacagaactgaatgggtacctgaggggccccagaaacagtggctgg
aactcagatacctcggtgacacctttcaatgtacccctgatgtcgttggccgcagggaag
gagatgaccatagacattcctgctatgaaggctccagaagggaagctgcagcttaagaca
gactgttgccccaaagagctgtctgtgaggctgagctatgggctctgtcccgaggagcag
gccttcctaagcaggaggaagaaggtggtggctgccgccctgaagcaggctctgcaactg
gatgaagacttgaacgaagatgaggtccctgttgtgggcatcaatgctgagggaggaggt
atgcgggctatgatctcactctacggccacctactggcgcttcagaagttgggcctcctg
gactgtgtgacctacttcagtggcatctcaggctctacatggacaatggcccacctgtac
agggacccagagtggtcacagagggacctcgaaggacccatcagtcatgctagggagcat
gtggctaaaaccctgctgaaggaattcctccccgaacacttggcaagctaccgccagaca
ctgaagcttcgggaagagcagggctacaccgtcacggtagcagacctgtggggcctggtg
ctggagtccaagctgcatgggcaggtgacagatcagaagctgtcaggacagagagctgca
ctggagaggggtcagaaccctttgcctctctacttgagcctcaatgtcaaagagaaccat
ctggaaaccctccacttcaaggaatgggtagagttctctccctatgaagttgggtttctg
aaatatggaggctttgtcccttctgagctcttcggctctgagttcttcatgggacggctg
atgaagagacttcccgagtcccagatttgctttctggaaggtatctggagcaaccttttc
tctgtgaacctgatggatatctggtatgacatcacctatgggaaagactcaaacaatttc
cctgtggatgtccggaactcagagaaggagttctcaggctcagcaggaacctcctctggt
gtggaggccccatggctggagtctggaacagctctggcccaggcacttaagggctttctg
actggcaggccattccaccagcgtagcgccaacttcctccatggcctccagctgcaccgg
gactactgtaaccagagacacttctccacctgggcggattgcaacctagatgacaccccg
aatcagctgaccccacaggaccctcagctctgcctaattgatgctggctgcttcatgaac
agcagctgtccctccctgttccgcccaggtcgccaagtggacctcataatctccttcaat
tacaaccaatcccttccctttaaggggctgcagcaatctgagaaatacagcagagctcgg
ggcctgcccttcccccgtgtggagcccagcccagaggaccacagccagccccaggaatgt
tacctcttctcagaccccacctgcccggaagcacccgttgtgctgcacttcccgctggtc
aatgactccttcagggatcactcagcccctggtgtcaggcgcagccctgatgagctcaag
gctgggcaggtgaatctcacaggggctgcctccccctacttcatgtacaacatgacctac
aagaacgaagatttcgaccggttgcttcagctctctgactacaatgttcagaacaaccag
ggcactatcctgcaggccctgaggacagttctgaaacggagggcttcagagaccaggcca
ttgggagtgaagacgtga

DBGET integrated database retrieval system